Tested Applications
| Positive WB detected in | DU 145 cells, LNCaP cells, PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31298-1-AP targets ANP32CP in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag35293 Product name: Recombinant human ANP32CP protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 141-234 aa of NM_012403.1 Sequence: LDSCYWDHKEAPYSDIEDHVEGLDDEEEGEHEEEYDEDAQVVEDEEGEEEEEEGEEEDVSGGDEEDEEGYNDGEVDGEEDEEELGEEERGQKRK Predict reactive species |
| Full Name | acidic (leucine-rich) nuclear phosphoprotein 32 family, member C |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 27-30 kDa |
| GenBank Accession Number | NM_012403.1 |
| Gene Symbol | ANP32C/PP32R1 |
| Gene ID (NCBI) | 23520 |
| RRID | AB_3669935 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | O43423 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ANP32CP (acidic nuclear phosphoprotein 32 family member C, pseudogene), also known as PP32R1. It is expected to be located in nucleus and perinuclear region of cytoplasm. Expressed in activated stem cells, such as mobilized CD34+ cells and cord blood CD34+ cells, but not in resting bone marrow CD34+ cells. Expressed in a variety of neoplastic cell lines, mainly in prostatic adenocarcinoma cell lines. Not expressed in normal prostatic tissue (PMID: 10086381). The calculated molecular weight of ANP32CP is 27 kDa. The protein could be the product of a pseudogene. Gene encoding ANP32CP is intronless suggesting that is pseudogene generated by retrotransposition.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ANP32CP antibody 31298-1-AP | Download protocol |
| WB protocol for ANP32CP antibody 31298-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





