Tested Applications
| Positive WB detected in | A549 cells, DU 145 cells, HeLa cells, K-562 cells, MCF-7 cells |
| Positive IHC detected in | mouse kidney tissue, human lung tissue, mouse small intestine tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse small intestine tissue |
| Positive IF/ICC detected in | SH-SY5Y cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:4000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:200-1:800 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
31989-1-AP targets ANP32E in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag33772 Product name: Recombinant human ANP32E protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 159-268 aa of BC003380 Sequence: EEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD* Predict reactive species |
| Full Name | acidic (leucine-rich) nuclear phosphoprotein 32 family, member E |
| Calculated Molecular Weight | 31 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC003380 |
| Gene Symbol | ANP32E |
| Gene ID (NCBI) | 81611 |
| RRID | AB_3670167 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity Purification |
| UNIPROT ID | Q9BTT0 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Acidic nuclear phosphoprotein 32 family member E (ANP32E) is a histone chaperone that removes H2A.Z from chromatin. ANP32E is implicated in many cellular processes, including chromatin modification and remodeling, gene regulation, protein phosphorylation, and regulation of intracellular trafficking, and contributes to early development and cancer metastasis in mammals. In addition, ANP32E is involved in tumor development and is highly expressed in pancreatic and thyroid cancer cells, and promotes tumorigenesis in gastric cancer (GC) cells by inducing NUF2 expression.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ANP32E antibody 31989-1-AP | Download protocol |
| IHC protocol for ANP32E antibody 31989-1-AP | Download protocol |
| WB protocol for ANP32E antibody 31989-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |













