ANP32E Polyclonal antibody

• 

  WB analysis using 31989-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31989-1-AP (ANP32E antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung using 31989-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 31989-1-AP (ANP32E antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse small intestine using 31989-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 31989-1-AP (ANP32E antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse kidney using 31989-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse kidney tissue slide using 31989-1-AP (ANP32E antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse small intestine using 31989-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using ANP32E antibody (31989-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of mouse small intestine using 31989-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded mouse small intestine tissue using ANP32E antibody (31989-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of SH-SY5Y using 31989-1-AP

  Immunofluorescent analysis of (4% PFA) fixed SH-SY5Y cells using ANP32E antibody (31989-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-Phalloidin (red).

ANP32E Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, ELISA

Cat No. 31989-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IF-P, ELISA

Synonyms

Acidic (Leucine-Rich) Nuclear Phosphoprotein 32 Family, Member E, Acidic leucine-rich nuclear phosphoprotein 32 family member E, Acidic Nuclear Phosphoprotein 32 Family Member E, LANPL, LANP-L

---

Tested Applications

• Positive WB detected in: A549 cells, DU 145 cells, HeLa cells, K-562 cells, MCF-7 cells
• Positive IHC detected in: mouse kidney tissue, human lung tissue, mouse small intestine tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: mouse small intestine tissue
• Positive IF/ICC detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)-P: IF-P : 1:200-1:800
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31989-1-AP targets ANP32E in WB, IHC, IF/ICC, IF-P, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag33772

  Product name: Recombinant human ANP32E protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 159-268 aa of BC003380

  Sequence: EEEDDEDGDEDDEEEEENEAGPPEGYEEEEEEEEEEDEDEDEDEDEAGSELGEGEEEVGLSYLMKEEIQDEEDDDDYVEEGEEEEEEEEGGLRGEKRKRDAEDDGEEEDD*

• Full Name: acidic (leucine-rich) nuclear phosphoprotein 32 family, member E
• Calculated Molecular Weight: 31 kDa
• Observed Molecular Weight: 30 kDa
• GenBank Accession Number: BC003380
• Gene Symbol: ANP32E
• Gene ID (NCBI): 81611
• RRID: AB_3670167
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q9BTT0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Acidic nuclear phosphoprotein 32 family member E (ANP32E) is a histone chaperone that removes H2A.Z from chromatin. ANP32E is implicated in many cellular processes, including chromatin modification and remodeling, gene regulation, protein phosphorylation, and regulation of intracellular trafficking, and contributes to early development and cancer metastasis in mammals. In addition, ANP32E is involved in tumor development and is highly expressed in pancreatic and thyroid cancer cells, and promotes tumorigenesis in gastric cancer (GC) cells by inducing NUF2 expression.