• Featured Product
  • KD/KO Validated

Annexin A7 Polyclonal antibody

Annexin A7 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA
Cat No. 10154-2-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

ANXA7, Annexin 7, Annexin VII, Annexin-7, ANX7

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, Jurkat cells, mouse lung tissue, L02 cells, mouse brain tissue, mouse heart tissue, HeLa cells, RAW 264.7 cells, rat brain tissue
Positive IP detected inU-87 MG cells, mouse heart tissue
Positive IHC detected inmouse heart tissue, human pancreas tissue, human prostate cancer tissue, human stomach tissue, human stomach cancer tissue, mouse stomach tissue, rat stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive FC (Intra) detected inSH-SY5Y cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:16000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

10154-2-AP targets Annexin A7 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag0206

Product name: Recombinant human ANXA7 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 236-466 aa of BC002632

Sequence: PTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ

Predict reactive species
Full Name annexin A7
Calculated Molecular Weight 50 kDa
Observed Molecular Weight 47 kDa, 51 kDa
GenBank Accession NumberBC002632
Gene Symbol Annexin A7
Gene ID (NCBI) 310
RRIDAB_2227386
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP20073
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A7 (Anx7) belongs to a ubiquitous and relatively abundant family of Ca2+-dependent membrane-binding proteins, which are thought to be involved in multiple aspects of cell biology including membrane trafficking, mediation of cell-matrix interactions and membrane organization within cells. Anx7, migrated as a 50 kDa protein in SDS-PAGE, has been proposed to function in the fusion of vesicles, acting as a Ca++ channel and as Ca++ -activated GTPase, thus inducing Ca++ /GTP-dependent secretory events.

Protocols

Product Specific Protocols
FC protocol for Annexin A7 antibody 10154-2-APDownload protocol
IHC protocol for Annexin A7 antibody 10154-2-APDownload protocol
IP protocol for Annexin A7 antibody 10154-2-APDownload protocol
WB protocol for Annexin A7 antibody 10154-2-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Matrix Biol

Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility.

Authors - Emna Ouni
humanWB

Am J Physiol Endocrinol Metab

Differential expression of the regulated catecholamine secretory pathway in different hereditary forms of pheochromocytoma.

Authors - Eisenhofer Graeme G
humanWB,IF

J Proteome Res

Quantitative Mitochondrial Proteomics Reveals ANXA7 as a Crucial Factor in Mitophagy.

Authors - Kun Meng
  • KD Validated
humanIHC

Am J Transl Res

Downregulation of annexin A7 decreases proliferation, migration, and invasion of gastric cancer cells by reducing matrix metalloproteinase 1 and 9 expression.

Authors - Hu-Fang Yuan
mouseWB

Biofactors

Ezrin as a possible diagnostic and/or prognostic biomarker in mice lymphatic metastatic hepatocellular carcinoma in vivo.

Authors - Ahmed Musa Hago Bakheet
humanWB

FEBS Lett

Annexins A1 and A2 are recruited to larger lysosomal injuries independently of ESCRTs to promote repair.

Authors - Willa Wen-You Yim
Loading...
||
New chat Able
正在加载,请稍候...