Annexin A7 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• Annexin A7 Polyclonal antibody (10154-2-AP)

• Featured Product
• KD/KO Validated

Annexin A7 Polyclonal Antibody for WB, IHC, FC (Intra), IP, ELISA

Cat No. 10154-2-AP Copied!

Publications (16)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, FC (Intra), IP, ELISA

Synonyms

ANXA7, Annexin 7, Annexin VII, Annexin-7, ANX7

• 

  WB analysis using 10154-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin A7 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 10154-2-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin A7 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of A549 using 10154-2-AP

  WB result of Annexin A7 antibody (10154-2-AP; 1:30000; incubated at room temperature for 1.5 hours) with sh-Control and sh-Annexin A7 transfected A549 cells.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse lung using 10154-2-AP

  mouse lung tissue were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin VII antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of L02 using 10154-2-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 10154-2-AP (Annexin VII antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of U-87 MG using 10154-2-AP

  IP result of anti-Annexin A7 (IP:10154-2-AP, 4ug; Detection:10154-2-AP 1:8000) with U-87 MG cells lysate 1160 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of mouse heart using 10154-2-AP

  IP result of anti-Annexin A7 (IP:10154-2-AP, 4ug; Detection:10154-2-AP 1:800) with mouse heart tissue lysate 3200ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human pancreas using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded human pancreas tissue slide using 10154-2-AP (Annexin VII antibody at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach cancer using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded human stomach cancer tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat stomach using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded rat stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse stomach using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse stomach tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:500 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse heart using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 10154-2-AP (Annexin A7 antibody) at dilution of 1:400 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10154-2-AP (Annexin VII antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human prostate cancer using 10154-2-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer tissue slide using 10154-2-AP (Annexin VII antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of SH-SY5Y using 10154-2-AP

  1X10^6 SH-SY5Y cells were intracellularly stained with 0.4 ug Anti-Human Annexin A7 (10154-2-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Control Antibody. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for Annexin A7 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: A549 cells, Jurkat cells, L02 cells, mouse lung tissue, HeLa cells, RAW 264.7 cells, rat brain tissue, mouse brain tissue, mouse heart tissue
• Positive IP detected in: U-87 MG cells, mouse heart tissue
• Positive IHC detected in: mouse heart tissue, human pancreas tissue, human prostate cancer tissue, human stomach tissue, human stomach cancer tissue, mouse stomach tissue, rat stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: SH-SY5Y cells

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:16000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

10154-2-AP targets Annexin A7 in WB, IHC, IF, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0206

  Product name: Recombinant human ANXA7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 236-466 aa of BC002632

  Sequence: PTYYDAWSLRKAMQGAGTQERVLIEILCTRTNQEIREIVRCYQSEFGRDLEKDIRSDTSGHFERLLVSMCQGNRDENQSINHQMAQEDAQRLYQAGEGRLGTDESCFNMILATRSFPQLRATMEAYSRMANRDLLSSVSREFSGYVESGLKTILQCALNRPAFFAERLYYAMKGAGTDDSTLVRIVVTRSEIDLVQIKQMFAQMYQKTLGTMIAGDTSGDYRRLLLAIVGQ

• Full Name: annexin A7
• Calculated Molecular Weight: 50 kDa
• Observed Molecular Weight: 47 kDa, 51 kDa
• GenBank Accession Number: BC002632
• Gene Symbol: Annexin A7
• Gene ID (NCBI): 310
• RRID: AB_2227386
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P20073
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Annexin A7 (Anx7) belongs to a ubiquitous and relatively abundant family of Ca2+-dependent membrane-binding proteins, which are thought to be involved in multiple aspects of cell biology including membrane trafficking, mediation of cell-matrix interactions and membrane organization within cells. Anx7, migrated as a 50 kDa protein in SDS-PAGE, has been proposed to function in the fusion of vesicles, acting as a Ca++ channel and as Ca++ -activated GTPase, thus inducing Ca++ /GTP-dependent secretory events.

Publications

What published studies show

The anti-ANXA7 antibody (Cat# 10154-2-AP) has 16 total citations published across 15 journals including Advanced Science, Cell Death & Discovery, Developmental Cell, Apoptosis, EMBO Journal, Matrix Biology, and others. Research fields span spinal cord injury repair, autophagy and mitophagy, gastric cancer progression and metastasis, hepatocellular carcinoma, neuronal protein trafficking, lysosomal and plasma membrane repair, pyroptosis, and oncofertility biomarker discovery. Applications include WB, IF, IHC, and IP in human, mouse, and rat models.

Automatically generated from the 16 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP,IHC,IF	Adv Sci (Weinh); Lipid Droplets Metabolism Mediated by ANXA7-PPARγ Signaling Axis Regulates Spinal Cord Injury Repair in Mice; Authors - Lu Chen
mouse	WB,IF	Cell Death Discov; Targeting ANXA7/LAMP5-mTOR axis attenuates spinal cord injury by inhibiting neuronal apoptosis via enhancing autophagy in mice; Authors - Na Li
		Dev Cell; The ALS- and FTD-associated proteins annexin A11 and CHMP2B act sequentially in plasma membrane repair.; Authors - Catherine M. Heffner
mouse,human	WB,IF	Apoptosis; RNF168 promotes chronic colitis through ANXA7-mediated autophagy and NLRP3-driven pyroptosis.; Authors - Honggang Wang ; KD Validated
rat	WB,IF	EMBO J; Annexin A7 enhances TIA1 axonal trafficking to counteract pathological aggregation in neurons.; Authors - Yu Feng
human	IF	Matrix Biol; Proteome-wide and matrisome-specific atlas of the human ovary computes fertility biomarker candidates and open the way for precision oncofertility.; Authors - Emna Ouni