Product Information
83613-6-PBS targets AP1M1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag2757 Product name: Recombinant human AP1M1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 164-423 aa of BC017469 Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ Predict reactive species |
| Full Name | adaptor-related protein complex 1, mu 1 subunit |
| Calculated Molecular Weight | 423 aa, 49 kDa |
| Observed Molecular Weight | 49 kDa |
| GenBank Accession Number | BC017469 |
| Gene Symbol | AP1M1 |
| Gene ID (NCBI) | 8907 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q9BXS5 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
AP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.













