• Featured Product
  • KD/KO Validated

AP1M1 Recombinant monoclonal antibody, PBS Only

AP1M1 Uni-rAb® Recombinant Antibody for WB, IHC, FC (Intra), ELISA
Cat No. 83613-6-PBS
Clone No.240553H3

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, FC (Intra), ELISA

AP-1 complex subunit mu-1, AP mu chain family member mu1A, AP 1 complex subunit mu 1, Adaptor-related protein complex 1 subunit mu-1, Adaptor protein complex AP-1 subunit mu-1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83613-6-PBS targets AP1M1 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2757

Product name: Recombinant human AP1M1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 164-423 aa of BC017469

Sequence: IKYRKNEVFLDVIESVNLLVSANGNVLRSEIVGSIKMRVFLSGMPELRLGLNDKVLFDNTGRGKSKSVELEDVKFHQCVRLSRFENDRTISFIPPDGEFELMSYRLNTHVKPLIWIESVIEKHSHSRIEYMIKAKSQFKRRSTANNVEIHIPVPNDADSPKFKTTVGSVKWVPENSEIVWSIKSFPGGKEYLMRAHFGLPSVEAEDKEGKPPISVKFEIPYFTTSGIQVRYLKIIEKSGYQALPWVRYITQNGDYQLRTQ

Predict reactive species
Full Name adaptor-related protein complex 1, mu 1 subunit
Calculated Molecular Weight 423 aa, 49 kDa
Observed Molecular Weight 49 kDa
GenBank Accession NumberBC017469
Gene Symbol AP1M1
Gene ID (NCBI) 8907
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDQ9BXS5
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

AP1M1, also named as CLTNM, Mu-adaptin 1 and Clathrin coat assembly protein AP47, belongs to the adaptor complexes medium subunit family. It is a subunit of clathrin-associated adaptor protein complex 1 that plays a role in protein sorting in the trans-Golgi network (TGN) and endosomes. The AP complexes mediate the recruitment of clathrin to membranes and the recognition of sorting signals within the cytosolic tails of transmembrane cargo molecules.

Loading...
||
New chat Able
正在加载,请稍候...