Use Able AI chat for product recommendations
  • KD/KO Validated

AP2A1 Polyclonal antibody

AP2A1 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 30030-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

100 kDa coated vesicle protein A, Adaptor protein complex AP-2 subunit alpha-1, Adaptor-related protein complex 2 subunit alpha-1, ADTAA, alpha Adaptin

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA431 cells, HEK-293 cells, MCF-7 cells, SKOV-3 cells, SH-SY5Y cells, mouse kidney tissue, rat kidney tissue, mouse kidney cells, rat kidney cells
Positive IHC detected inhuman stomach cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:12000
Immunohistochemistry (IHC)IHC : 1:600-1:2400
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

30030-1-AP targets AP2A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag32232

Product name: Recombinant human AP2A1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 616-724 aa of BC014214

Sequence: LKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADLLGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNK

Predict reactive species
Full Name adaptor-related protein complex 2, alpha 1 subunit
Calculated Molecular Weight 977 aa, 108 kDa
Observed Molecular Weight108 kDa
GenBank Accession NumberBC014214
Gene Symbol AP2A1
Gene ID (NCBI) 160
RRIDAB_2935505
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDO95782
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP2A1 encodes adaptor protein complex 2 (AP-2) subunit alpha-1, which is a 100 kDa coated vesicle protein. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is involved in clathrin-dependent endocytosis.

Protocols

Product Specific Protocols
IHC protocol for AP2A1 antibody 30030-1-APDownload protocol
WB protocol for AP2A1 antibody 30030-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...