Tested Applications
| Positive WB detected in | A431 cells, HEK-293 cells, MCF-7 cells, SKOV-3 cells, SH-SY5Y cells, mouse kidney tissue, rat kidney tissue, mouse kidney cells, rat kidney cells |
| Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:12000 |
| Immunohistochemistry (IHC) | IHC : 1:600-1:2400 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
30030-1-AP targets AP2A1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag32232 Product name: Recombinant human AP2A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 616-724 aa of BC014214 Sequence: LKRKKGPGAGSALDDGRRDPSSNDINGGMEPTPSTVSTPSPSADLLGLRAAPPPAAPPASAGAGNLLVDVFDGPAAQPSLGPTPEEAFLSPGPEDIGPPIPEADELLNK Predict reactive species |
| Full Name | adaptor-related protein complex 2, alpha 1 subunit |
| Calculated Molecular Weight | 977 aa, 108 kDa |
| Observed Molecular Weight | 108 kDa |
| GenBank Accession Number | BC014214 |
| Gene Symbol | AP2A1 |
| Gene ID (NCBI) | 160 |
| RRID | AB_2935505 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O95782 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AP2A1 encodes adaptor protein complex 2 (AP-2) subunit alpha-1, which is a 100 kDa coated vesicle protein. Adaptor protein (AP) complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes are involved in the formation of clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in the cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is involved in clathrin-dependent endocytosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for AP2A1 antibody 30030-1-AP | Download protocol |
| WB protocol for AP2A1 antibody 30030-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





