AP2S1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84174-3-RR (same clone as 84174-3-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84174-3-RR (AP2S1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84174-3-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 84174-3-RR (same clone as 84174-3-PBS)

  WB result of AP2S1 antibody (84174-3-RR; 1:2000; incubated at room temperature for 1.5 hours) with sh-Control and sh-AP2S1 transfected HEK-293 cells. This data was developed using the same antibody clone with 84174-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse testis using 84174-3-RR (same clone as 84174-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 84174-3-RR (AP2S1 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 84174-3-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 84174-3-RR (same clone as 84174-3-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using AP2S1 antibody (84174-3-RR, Clone: 241369F1 ) at dilution of 1:250 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 84174-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84174-3-RR

  Biolayer interferometry (BLl) kinetic assays of 84174-3-RR against Human AP2S1 were performed. The affinity constant is 0.502 nM.

• Featured Product
• KD/KO Validated

AP2S1 Uni-rAb^® Recombinant Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 84174-3-PBS

Clone No.241369F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

241369F1, Adaptor protein complex AP-2 subunit sigma, Adaptor-related protein complex 2 subunit sigma, AP 2 complex subunit sigma, AP17

---

Product Information

84174-3-PBS targets AP2S1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag8095

  Product name: Recombinant human AP2S1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-142 aa of BC006337

  Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

• Full Name: adaptor-related protein complex 2, sigma 1 subunit
• Calculated Molecular Weight: 142 aa, 17 kDa
• Observed Molecular Weight: 15-17 kDa
• GenBank Accession Number: BC006337
• Gene Symbol: AP2S1
• Gene ID (NCBI): 1175
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: P53680
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

AP2S1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes form clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is composed of two large adaptins (alpha-type subunit AP2A1 or AP2A2 and beta-type subunit AP2B1), a medium adaptin (mu-type subunit AP2M1), and a small adaptin (sigma-type subunit AP2S1). It works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis. Missense mutations of AP2S1 affect Arg15 and lead to familial hypocalciuric hypercalcemia type 3 (FHH3), an extracellular calcium homeostasis disorder affecting the parathyroids, kidneys, and bone (PMID: 23222959).