• Featured Product
  • KD/KO Validated

AP2S1 Recombinant monoclonal antibody

AP2S1 Uni-rAb® Recombinant Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 84174-3-RR
Clone No.241369F1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

241369F1, Adaptor protein complex AP-2 subunit sigma, Adaptor-related protein complex 2 subunit sigma, AP 2 complex subunit sigma, AP17

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSH-SY5Y cells, HEK-293 cells, mouse brain tissue, mouse kidney tissue, rat brain tissue
Positive IHC detected inmouse testis tissue, human thyroid tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:8000
Immunohistochemistry (IHC)IHC : 1:400-1:1600
Immunofluorescence (IF)/ICCIF/ICC : 1:125-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

84174-3-RR targets AP2S1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag8095

Product name: Recombinant human AP2S1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-142 aa of BC006337

Sequence: MIRFILIQNRAGKTRLAKWYMQFDDDEKQKLIEEVHAVVTVRDAKHTNFVEFRNFKIIYRRYAGLYFCICVDVNDNNLAYLEAIHNFVEVLNEYFHNVCELDLVFNFYKVYTVVDEMFLAGEIRETSQTKVLKQLLMLQSLE

Predict reactive species
Full Name adaptor-related protein complex 2, sigma 1 subunit
Calculated Molecular Weight 142 aa, 17 kDa
Observed Molecular Weight15-17 kDa
GenBank Accession NumberBC006337
Gene Symbol AP2S1
Gene ID (NCBI) 1175
RRIDAB_3671731
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purfication
UNIPROT IDP53680
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AP2S1 is a component of the adaptor protein complex 2 (AP-2). AP complexes are cytosolic heterotetramers that mediate the sorting of membrane proteins in the secretory and endocytic pathways. AP complexes form clathrin-coated vesicles (CCVs) by recruiting the scaffold protein, clathrin. AP complexes also play a pivotal role in cargo selection by recognizing the sorting signals within the cytoplasmic tail of integral membrane proteins. AP-2 is composed of two large adaptins (alpha-type subunit AP2A1 or AP2A2 and beta-type subunit AP2B1), a medium adaptin (mu-type subunit AP2M1), and a small adaptin (sigma-type subunit AP2S1). It works on the plasma membrane to internalize cargo in clathrin-mediated endocytosis. Missense mutations of AP2S1 affect Arg15 and lead to familial hypocalciuric hypercalcemia type 3 (FHH3), an extracellular calcium homeostasis disorder affecting the parathyroids, kidneys, and bone (PMID: 23222959).

Protocols

Product Specific Protocols
IF protocol for AP2S1 antibody 84174-3-RRDownload protocol
IHC protocol for AP2S1 antibody 84174-3-RRDownload protocol
WB protocol for AP2S1 antibody 84174-3-RRDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat

Able

正在加载,请稍候...