AP4S1 Polyclonal antibody, PBS Only

• 

  IHC staining of mouse brain using 27202-1-AP (same clone as 27202-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27202-1-AP (AP4S1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27202-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 27202-1-AP (same clone as 27202-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 27202-1-AP (AP4S1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27202-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27202-1-AP (same clone as 27202-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27202-1-AP (AP4S1 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27202-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 27202-1-AP (same clone as 27202-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain tissue slide using 27202-1-AP (AP4S1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 27202-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 27202-1-AP (same clone as 27202-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using AP4S1 antibody (27202-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27202-1-PBS in a different storage buffer formulation.

• 

  IF Staining of mouse brain using 27202-1-AP (same clone as 27202-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed mouse brain tissue using AP4S1 antibody (27202-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 27202-1-PBS in a different storage buffer formulation.

AP4S1 Polyclonal Antibody for IHC, IF-P, Indirect ELISA

Cat No. 27202-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF-P, Indirect ELISA

Synonyms

---

Product Information

27202-1-PBS targets AP4S1 in IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25661

  Product name: Recombinant human AP4S1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 5-98 aa of BC001259

  Sequence: FLMVNKQGQTRLSKYYEHVDINKRTLLETEVIKSCLSRSNEQCSFIEYKDFKLIYRQYAALFIVVGVNDTENEMAIYEFIHNFVEVLDEYFSRV

• Full Name: adaptor-related protein complex 4, sigma 1 subunit
• Calculated Molecular Weight: 17 kDa
• Observed Molecular Weight: 17 kDa
• GenBank Accession Number: BC001259
• Gene Symbol: AP4S1
• Gene ID (NCBI): 11154
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y587
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.