APOL4 Polyclonal antibody, PBS Only

• 

  WB analysis using 10564-1-AP (same clone as 10564-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10564-1-AP (APOL4 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 10564-1-AP (same clone as 10564-1-PBS)

  IP result of anti-APOL4 (IP:10564-1-AP, 4ug; Detection:10564-1-AP 1:2000) with HepG2 cells lysate 4000ug. This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10564-1-AP (same clone as 10564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10564-1-AP (APOL4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver cancer using 10564-1-AP (same clone as 10564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 10564-1-AP (APOL4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10564-1-AP (same clone as 10564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10564-1-AP (APOL4 Antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human liver using 10564-1-AP (same clone as 10564-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 10564-1-AP (APOL4 Antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10564-1-AP (same clone as 10564-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using APOL4 antibody (10564-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2). This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 10564-1-AP (same clone as 10564-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HepG2 cells using 10564-1-AP (APOL4 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10564-1-PBS in a different storage buffer formulation.

APOL4 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 10564-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

10564-1-PBS targets APOL4 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0849

  Product name: Recombinant human APOL4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-107 aa of BC006276

  Sequence: MGSWVQLITSVGTSGLFLGVRVREEGAGMRCSKTIQAGQWLDSSKGPLGPSPPPVPTAGYSSSFCVHYVNLLPGVLVLSVTSQYPHLSMALCQLAAHDWPRLSCVCV

• Full Name: apolipoprotein L, 4
• Calculated Molecular Weight: 39 kDa
• Observed Molecular Weight: 40-50 kDa
• GenBank Accession Number: BC006276
• Gene Symbol: APOL4
• Gene ID (NCBI): 80832
• RRID: AB_2242901
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9BPW4
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.