Tested Applications
| Positive WB detected in | mouse lung tissue, rat lung tissue |
| Positive IHC detected in | mouse lung tissue, mouse kidney tissue, rat kidney tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | rat lung tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:2500-1:10000 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 14 publications below |
| IHC | See 3 publications below |
| IF | See 10 publications below |
Product Information
20334-1-AP targets AQP5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, chicken |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14103 Product name: Recombinant human AQP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 190-265 aa of BC032946 Sequence: FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR Predict reactive species |
| Full Name | aquaporin 5 |
| Calculated Molecular Weight | 265 aa, 28 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC032946 |
| Gene Symbol | AQP5 |
| Gene ID (NCBI) | 362 |
| RRID | AB_2918066 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55064 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
AQP5 is a member of aquaporins (AQPs) which are membrane proteins functioning as water channels and involved in the bidirectional transfer of water and small solutes across cell membranes. AQP5 is widely expressed including digestive, renal, respiratory, and reproductive systems. AQP5 overexpression in cancer cells and tumor tissues has been extensively reported. Recently AQP5 has been identified as a marker for adult pyloric stem cells.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for AQP5 antibody 20334-1-AP | Download protocol |
| IHC protocol for AQP5 antibody 20334-1-AP | Download protocol |
| WB protocol for AQP5 antibody 20334-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Int J Mol Sci Ezrin Is a Novel Protein Partner of Aquaporin-5 in Human Salivary Glands and Shows Altered Expression and Cellular Localization in Sjögren's Syndrome | ||
FASEB J Circadian rhythm disruptions exacerbate inner ear damage in a murine endolymphatic hydrops model | ||
Eur J Pharm Biopharm Nebulized MSC exosomes promote the transdifferentiation of transitional state cells against acute lung injury through STAT3/Krt8/AQP5 axis | ||
J Ethnopharmacol Processed product (Pinelliae Rhizoma Praeparatum) of Pinellia ternata (Thunb.) Breit. Alleviates the allergic airway inflammation of cold phlegm via regulation of PKC/EGFR/MAPK/PI3K-AKT signaling pathway. | ||
Front Genet A New Homotetramer Hemoglobin in the Pulmonary Surfactant of Plateau Zokors (Myospalax Baileyi). | ||















