AQP5 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• AQP5 Polyclonal antibody (20334-1-AP)

AQP5 Polyclonal Antibody for WB, IHC, IF-P, ELISA

Cat No. 20334-1-AP Copied!

Publications (46)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (1)

Applications

WB, IHC, IF-P, ELISA

Synonyms

aquaporin 5, AQP 5, AQP-5, aquaporin5, Aquaporin-5

• 

  WB analysis using 20334-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20334-1-AP (AQP5 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 20334-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 20334-1-AP (AQP5 antibody) at dilution of 1:5000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse lung using 20334-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 20334-1-AP (AQP5 antibody) at dilution of 1:5000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 20334-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 20334-1-AP (AQP5 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of rat kidney using 20334-1-AP

  Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 20334-1-AP (AQP5 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of rat lung using 20334-1-AP

  Immunofluorescent analysis of (4% PFA) fixed paraffin-embedded rat lung tissue using AQP5 antibody (20334-1-AP) at dilution of 1:200 and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for AQP5 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: mouse lung tissue, rat lung tissue
• Positive IHC detected in: mouse lung tissue, rat kidney tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF-P detected in: rat lung tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:2500-1:10000
• Immunofluorescence (IF)-P: IF-P : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20334-1-AP targets AQP5 in WB, IHC, IF-P, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14103

  Product name: Recombinant human AQP5 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 190-265 aa of BC032946

  Sequence: FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR

• Full Name: aquaporin 5
• Calculated Molecular Weight: 265 aa, 28 kDa
• Observed Molecular Weight: 27 kDa
• GenBank Accession Number: BC032946
• Gene Symbol: AQP5
• Gene ID (NCBI): 362
• RRID: AB_2918066
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P55064
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

AQP5 is a member of aquaporins (AQPs) which are membrane proteins functioning as water channels and involved in the bidirectional transfer of water and small solutes across cell membranes. AQP5 is widely expressed including digestive, renal, respiratory, and reproductive systems. AQP5 overexpression in cancer cells and tumor tissues has been extensively reported. Recently AQP5 has been identified as a marker for adult pyloric stem cells.

Publications

What published studies show

The AQP5 Polyclonal antibody (Cat# 20334-1-AP) has 46 citations. Publications appear in journals including Nature Communications, Redox Biology, Theranostics, Biomaterials, Free Radical Biology and Medicine, Frontiers in Immunology, Journal of Ethnopharmacology, and PLoS ONE. Research fields span pulmonary medicine (lung injury, fibrosis, bronchopulmonary dysplasia, ARDS), salivary/lacrimal gland disorders (Sjögren's syndrome, xerostomia), inflammation, ferroptosis, aging, and cancer, using applications such as WB, IF, and IHC across mouse, rat, human, and chicken models.

Automatically generated from the 46 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	IF	Nat Commun; FGF 13 functions as a regulator of the ERK/aerobic glycolysis axis in the inflammatory state during septic lung injury.; Authors - Junjie Zhu
		Redox Biol; Redox signaling-mediated S-glutathionylation of protein disulfide isomerase A1 initiates intrinsic apoptosis and contributes to accelerated aging; Authors - Zhi-Wei Ye
		Redox Biol; Norepinephrine attenuates acute lung injury by protecting mitochondria via the β(2)-AR-AKAP1 axis and inhibiting alveolar epithelial pyroptosis.; Authors - Yiyuan Yin
rat	WB	Theranostics; Exosomes of human adipose stem cells mitigate irradiation injury to salivary glands by inhibiting epithelial-mesenchymal transition through miR-199a-3p targeting Twist1 and regulating TGFβ1/Smad3 pathway; Authors - Xiaotong Guo
mouse	IF	Biomaterials; Inhaled pulmonary surfactant biomimetic liposomes for reversing idiopathic pulmonary fibrosis through synergistic therapeutic strategy; Authors - Binghua Wang
mouse	IHC	Phytomedicine; β-Eudesmol in Rhizoma Atractylodis targets AVPR2 to inhibit the cAMP-AQP2 pathway and promote fluid metabolism; Authors - Chang Ke