Product Information
20334-1-PBS targets AQP5 in WB, IHC, IF-P, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14103 Product name: Recombinant human AQP5 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 190-265 aa of BC032946 Sequence: FGPAVVMNRFSPAHWVFWVGPIVGAVLAAILYFYLLFPNSLSLSERVAIIKGTYEPDEDWEEQREERKKTMELTTR Predict reactive species |
| Full Name | aquaporin 5 |
| Calculated Molecular Weight | 265 aa, 28 kDa |
| Observed Molecular Weight | 27 kDa |
| GenBank Accession Number | BC032946 |
| Gene Symbol | AQP5 |
| Gene ID (NCBI) | 362 |
| RRID | AB_2918066 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P55064 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
AQP5 is a member of aquaporins (AQPs) which are membrane proteins functioning as water channels and involved in the bidirectional transfer of water and small solutes across cell membranes. AQP5 is widely expressed including digestive, renal, respiratory, and reproductive systems. AQP5 overexpression in cancer cells and tumor tissues has been extensively reported. Recently AQP5 has been identified as a marker for adult pyloric stem cells.















