Tested Applications
Positive WB detected in | HeLa cells, A431 cells, NIH/3T3 cells |
Positive IHC detected in | human skin cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 3 publications below |
IHC | See 1 publications below |
IF | See 2 publications below |
Product Information
22129-1-AP targets ARAF in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag17588 Product name: Recombinant human ARAF protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 225-324 aa of BC007514 Sequence: STTAPMDSNLIQLTGQSFSTDAAGSRGGSDGTPRGSPSPASVSSGRKSPHSKSPAEQRERKSLADDKKKVKNLGYRDSGYYWEVPPSEVQLLKRIGTGSF Predict reactive species |
Full Name | v-raf murine sarcoma 3611 viral oncogene homolog |
Calculated Molecular Weight | 609 aa, 68 kDa |
Observed Molecular Weight | 33 kDa |
GenBank Accession Number | BC007514 |
Gene Symbol | ARAF |
Gene ID (NCBI) | 369 |
RRID | AB_2879001 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P10398 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARAF(Serine/threonine-protein kinase A-Raf) is also named as ARAF1, PKS, PKS2 and belongs to the protein kinase superfamily. It is involved in the transduction of mitogenic signals from the cell membrane to the nucleus. It has 2 isoforms produced by alternative splicing and the isoform 2 serves as a positive regulator of myogenic differentiation by inducing cell cycle arrest, the expression of myogenin and other muscle-specific proteins, and myotube formation.(PMID:17535970).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ARAF antibody 22129-1-AP | Download protocol |
IHC protocol for ARAF antibody 22129-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Anal Chem Ionic Liquid-Based Extraction System for In-Depth Analysis of Membrane Protein Complexes. | ||
Oncol Lett Novel recombinant protein FlaA N/C increases tumor radiosensitivity via NF-κB signaling in murine breast cancer cells. | ||
Front Med 5'-tiRNA-Gln inhibits hepatocellular carcinoma progression by repressing translation through the interaction with eukaryotic initiation factor 4A-I | ||
iScience Mission SpaceX CRS-19 RRRM-1 space flight induced skin genomic plasticity via an epigenetic trigger |