ARFGAP3 Polyclonal antibody, PBS Only

• 

  WB analysis of HepG2 using 15293-1-AP (same clone as 15293-1-PBS)

  HepG2 cells were subjected to SDS PAGE followed by western blot with 15293-1-AP (ARFGAP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 15293-1-AP (same clone as 15293-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15293-1-AP (ARFGAP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 15293-1-AP (same clone as 15293-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 15293-1-AP (ARFGAP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HepG2 using 15293-1-AP (same clone as 15293-1-PBS)

  IP result of anti-ARFGAP3 (IP:15293-1-AP, 4ug; Detection:15293-1-AP 1:2000) with HepG2 cells lysate 3000 ug. This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15293-1-AP (same clone as 15293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15293-1-AP (ARFGAP3 Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15293-1-AP (same clone as 15293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15293-1-AP (ARFGAP3 Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15293-1-AP (same clone as 15293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15293-1-AP (ARFGAP3 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15293-1-AP (same clone as 15293-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15293-1-AP (ARFGAP3 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 15293-1-AP (same clone as 15293-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using ARFGAP3 antibody (15293-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red). This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 15293-1-AP (same clone as 15293-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed A431 cells using ARFGAP3 antibody (15293-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L), CoraLite®594 Beta Actin antibody (CL594-66009, Clone: 2D4H5, red). This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IF Staining of A431 using 15293-1-AP (same clone as 15293-1-PBS)

  Immunofluorescent analysis of A431 cells using 15293-1-AP (ARFGAP3 antibody) at dilution of 1:25 and Rhodamine-Goat anti-Rabbit IgG. This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 15293-1-AP (same clone as 15293-1-PBS)

  Immunofluorescent analysis of HepG2 cells using 15293-1-AP (ARFGAP3 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15293-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARFGAP3 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 15293-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

ARFGAP1, ARF GAP 3, ADP-ribosylation factor GTPase-activating protein 3

---

Product Information

15293-1-PBS targets ARFGAP3 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7536

  Product name: Recombinant human ARFGAP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-346 aa of BC005122

  Sequence: MGDPSKQDILTIFKRLRSVPTNKVCFDCGAKNPSWASITYGVFLCIDCSGSHRSLGVHLSFIRSTELDSNWSWFQLRCMQVGGNASASSFFHQHGCSTNDTNAKYNSRAAQLYREKIKSLASQATRKHGTDLWLDSCVVPPLSPPPKEEDFFASHVSPEVSDTAWASAIAEPSSLTSRPVETTLENNEGGQEQGPSVEGLNVPTKATLEVSSIIKKKPNQAKKGLGAKKGSLGAQKLANTCFNEIEKQAQAADKMKEQEDLAKVVSKEESIVSSLRLAYKDLEIQMKKDEKMNISGKKNVDSDRLGMGFGNCRSVISHSVTSDMQTIEQESPIMAKPRKKYNDDSD

• Full Name: ADP-ribosylation factor GTPase activating protein 3
• Calculated Molecular Weight: 57 kDa
• Observed Molecular Weight: 57-66 kDa
• GenBank Accession Number: BC005122
• Gene Symbol: ARFGAP3
• Gene ID (NCBI): 26286
• RRID: AB_10804035
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9NP61
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARFGAP3, also named as ADP-ribosylation factor GTPase-activating protein 3, is a 516 amino acid protein, which is Widely expressed with Highest expression in endocrine glands (pancreas, pituitary gland, salivary gland, and prostate). ARFGAP3 is a GTPase-activating protein (GAP) for ADP ribosylation factor 1 (ARF1). Hydrolysis of ARF1-bound GTP may lead to dissociation of coatomer from Golgi-derived membranes to allow fusion with target membranes. The calculated molecular weight of ARFGAP3 is 57 kDa, but modified ARFGAP3 is about 57-66 kDa.