Arginase-1 Polyclonal antibody

Arginase-1 Polyclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 16001-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA

ARG1, Arginase 1, liver Arginase, ARG 1, Arg-1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inmouse liver tissue, rat liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inhuman liver cancer tissue, mouse liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue, human liver cancer tissue
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)-PIF-P : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

16001-1-AP targets Arginase-1 in WB, IHC, IF/ICC, IF-P, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag8595

Product name: Recombinant human ARG1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-236 aa of BC005321

Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Predict reactive species
Full Name arginase, liver
Calculated Molecular Weight236aa,25 kDa; 322aa,35 kDa
Observed Molecular Weight 35-36 kDa
GenBank Accession NumberBC005321
Gene Symbol Arginase-1
Gene ID (NCBI) 383
RRIDAB_2289842
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP05089
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation and ARG1 has been shown to protect motor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins (PMID: 20071539, PMID:12098359). It can exist as a homotrimer and has 3 isoforms produced by alternative splicing (PMID:16141327). Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control (PMID:27117406). ARG1 is mainly expresses in neurons in a normal brain. The expression of ARG1 increases in microglia/macrophages and astrocytes early after CNS injuries. ARG1 has been regarded as a marker for beneficial microglia/macrophages and possesses anti-inflammatory and tissue repair properties under various pathological conditions (PMID: 26538310, PMID: 31619589).

Protocols

Product Specific Protocols
IF protocol for Arginase-1 antibody 16001-1-APDownload protocol
IHC protocol for Arginase-1 antibody 16001-1-APDownload protocol
IP protocol for Arginase-1 antibody 16001-1-APDownload protocol
WB protocol for Arginase-1 antibody 16001-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseIF

Adv Mater

Realizing Highly Efficient Sonodynamic Bactericidal Capability through the Phonon-Electron Coupling Effect Using Two-Dimensional Catalytic Planar Defects

Authors - Congyang Mao
mouseWB

Bioact Mater

One-step strategy for fabricating icariin-encapsulated biomimetic Scaffold: Orchestrating immune, angiogenic, and osteogenic cascade for enhanced bone regeneration

Authors - Fengxin Zhao
mouseWB

Bioact Mater

Catalyst-modulated hydrogel dynamics for decoupling viscoelasticity and directing macrophage fate for diabetic wound healing

Authors - Yuening Mai
humanWB

Sci Transl Med

An extracorporeal bioartificial liver embedded with 3D-layered human liver progenitor-like cells relieves acute liver failure in pigs.

Authors - Wei-Jian Li
humanIF

Adv Sci (Weinh)

Material Stiffness in Cooperation with Macrophage Paracrine Signals Determines the Tenogenic Differentiation of Mesenchymal Stem Cells

Authors - Renwang Sheng

Adv Sci (Weinh)

eIF4E Enriched Extracellular Vesicles Induce Immunosuppressive Macrophages through HMGCR-Mediated Metabolic Rewiring

Authors - Sonam Mittal

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Debanjan (Verified Customer) (12-23-2019)

This antibody performs very well for immunohistochemistry from human skin samples

  • Applications: Immunofluorescence,
  • Primary Antibody Dilution: 1:50
  • Cell Tissue Type: Human skin Biopsy
Arginase-1 Antibody Immunofluorescence, validation (1:50 dilution) in Human skin Biopsy (Cat no:16001-1-AP)
Loading...
||
New chat

Able

正在加载,请稍候...