• Featured Product
  • KD/KO Validated

Arginase-1 Monoclonal antibody

Arginase-1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, ELISA

Cat No. 66129-1-Ig
Clone No.5D6D12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, IF-P, IP, ELISA

ARG1, Arginase 1, liver Arginase, 5D6D12, ARG 1

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inpig liver tissue, rat liver tissue, mouse liver tissue, rabbit liver tissue
Positive IP detected inmouse liver tissue
Positive IHC detected inmouse liver tissue, human liver tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inmouse liver tissue
Positive IF/ICC detected inHepG2 cells, mouse liver tissue

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:2000-1:5000
Immunofluorescence (IF)-PIF-P : 1:200-1:800
Immunofluorescence (IF)/ICCIF/ICC : 1:400-1:1600
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66129-1-Ig targets Arginase-1 in WB, IHC, IF/ICC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat, pig, rabbit samples.

Tested Reactivity human, mouse, rat, pig, rabbit
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8810

Product name: Recombinant human ARG1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-236 aa of BC005321

Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Predict reactive species
Full Name arginase, liver
Calculated Molecular Weight236aa,25 kDa; 322aa,35 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC005321
Gene Symbol Arginase-1
Gene ID (NCBI) 383
RRIDAB_2881528
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05089
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation and ARG1 has been shown to protectmotor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins (PMID: 20071539, PMID:12098359). It can exsit as a homotrimer and it has 3 isoforms produced by alternative splicing (PMID:16141327). Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control (PMID:27117406). Before stroke, ARG1 mainly expressed in neurons in a normal brain (PMID: 23311438). The expression of ARG1 increases in microglia/macrophages and astrocytes early after CNS injuries. ARG1 has been regarded as a marker for beneficial microglia/macrophages and possesses antiinflammatory and tissue repair properties under various pathological conditions (PMID: 26538310, PMID: 31619589).

Protocols

Product Specific Protocols
IF protocol for Arginase-1 antibody 66129-1-IgDownload protocol
IHC protocol for Arginase-1 antibody 66129-1-IgDownload protocol
IP protocol for Arginase-1 antibody 66129-1-IgDownload protocol
WB protocol for Arginase-1 antibody 66129-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouse,humanWB,IF

Immunity

Excessive Polyamine Generation in Keratinocytes Promotes Self-RNA Sensing by Dendritic Cells in Psoriasis.

Authors - Fangzhou Lou
ratIF

Bioact Mater

3D printing of interferon γ-preconditioned NSC-derived exosomes/collagen/chitosan biological scaffolds for neurological recovery after TBI

Authors - Chong Chen
WB,IHC

Adv Sci (Weinh)

Elevated Histone Lactylation Mediates Ferroptosis Resistance in Endometriosis Through the METTL3-Regulated HIF1A/HMOX1 Signaling Pathway

Authors - Zongwen Liang
mouseIF

J Control Release

Gut commensal bacteria Parabacteroides goldsteinii-derived outer membrane vesicles suppress skin inflammation in psoriasis

Authors - Dandan Su
mouseIF

J Nanobiotechnology

Inflammatory memory-activated biomimetic nanovesicles regulate neutrophil plasticity and metabolic reprogramming for rapid diabetic wound healing via targeting miR-193a-5p/TLR4/JNK/P38 MAPK pathways

Authors - Yunlong Fan
mouseWB

Adv Healthc Mater

A Smart MMP-9-responsive Hydrogel Releasing M2 Macrophage-derived Exosomes for Diabetic Wound Healing

Authors - Hao Meng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Marion (Verified Customer) (11-24-2024)

DAPI (blue) + Iba1 (Red) + Arg1 (green) Arg1 colocalizes with Iba1 staining M2-type microglia in this model of AD. We are satisfied with the results.

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1/600
  • Cell Tissue Type: Mouse Brain
Arginase-1 Antibody Immunofluorescence validation (1/600 dilution) in Mouse Brain (Cat no:66129-1-Ig)
Loading...
||
New chat

Able

正在加载,请稍候...