• Featured Product
  • KD/KO Validated

Arginase-1 Monoclonal antibody, PBS Only (Detector)

Arginase-1 Monoclonal Antibody for WB, IHC, IF/ICC, IF-P, IP, Cytometric bead array, Indirect ELISA, Sample test
Cat No. 66129-1-PBS
Clone No.5D6D12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig, rabbit

Applications

WB, IHC, IF/ICC, IF-P, IP, Cytometric bead array, Indirect ELISA, Sample test

ARG1, Arginase 1, liver Arginase, 5D6D12, ARG 1

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

66129-1-PBS targets Arginase-1 as part of a matched antibody pair:

MP51326-2: 66129-2-PBS capture and 66129-1-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat, pig, rabbit
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8810

Product name: Recombinant human ARG1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-236 aa of BC005321

Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Predict reactive species
Full Name arginase, liver
Calculated Molecular Weight236aa,25 kDa; 322aa,35 kDa
Observed Molecular Weight 36 kDa
GenBank Accession NumberBC005321
Gene Symbol Arginase-1
Gene ID (NCBI) 383
RRIDAB_2881528
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05089
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation and ARG1 has been shown to protectmotor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins (PMID: 20071539, PMID:12098359). It can exsit as a homotrimer and it has 3 isoforms produced by alternative splicing (PMID:16141327). Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control (PMID:27117406). Before stroke, ARG1 mainly expressed in neurons in a normal brain (PMID: 23311438). The expression of ARG1 increases in microglia/macrophages and astrocytes early after CNS injuries. ARG1 has been regarded as a marker for beneficial microglia/macrophages and possesses antiinflammatory and tissue repair properties under various pathological conditions (PMID: 26538310, PMID: 31619589).

Loading...
||
New chat Able
正在加载,请稍候...