• Featured Product
  • KD/KO Validated

CoraLite®594-conjugated Arginase-1 Monoclonal antibody

Arginase-1 Monoclonal Antibody for IF/ICC
Cat No. CL594-66129
Clone No.5D6D12

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat, pig

Applications

IF/ICC

ARG1, Arginase 1, liver Arginase, arginase, liver, Arg-1

Formulation:  PBS, Proclin 300, BSA, Glycerol
PBS, Proclin 300, BSA, Glycerol
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Published Applications

IFSee 5 publications below

Product Information

CL594-66129 targets Arginase-1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.

Tested Reactivity human, mouse, rat, pig
Cited Reactivityhuman, mouse
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag8810

Product name: Recombinant human ARG1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 1-236 aa of BC005321

Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK

Predict reactive species
Full Name arginase, liver
Calculated Molecular Weight236aa,25 kDa; 322aa,35 kDa
GenBank Accession NumberBC005321
Gene Symbol Arginase-1
Gene ID (NCBI) 383
RRIDAB_2883522
Conjugate CoraLite®594 Fluorescent Dye
Excitation/Emission Maxima Wavelengths588 nm / 604 nm
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP05089
Storage Buffer PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3.
Storage ConditionsStore at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage.

Background Information

Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation(PMID:12098359) and ARG1 has been shown to protectmotor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins(PMID: 20071539).It can exsit as a homotrimer(PMID:16141327) and it has 3 isoforms produced by alternative splicing.Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control.(PMID:27117406). ARG1 is a novel biomarker of post-stroke immune suppression(2016). The antibody is conjugated with CL594, Ex/Em 593 nm/614 nm.

Protocols

Product Specific Protocols
IF protocol for CL594 Arginase-1 antibody CL594-66129Download protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanIF

Adv Sci (Weinh)

Wireless Localized Electrical Stimulation Generated by an Ultrasound-Driven Piezoelectric Discharge Regulates Proinflammatory Macrophage Polarization.

Authors - Ying Kong
IF

ACS Nano

Biomimetic Trypsin-Responsive Structure-Bridged Mesoporous Organosilica Nanomedicine for Precise Treatment of Acute Pancreatitis

Authors - Yanan Wang
mouseIF

Adv Sci (Weinh)

ROS-Driven Nanoventilator for MRSA-Induced Acute Lung Injury Treatment via In Situ Oxygen Supply, Anti-Inflammation and Immunomodulation

Authors - Zheng Luo
IF

Adv Sci (Weinh)

Natural Enzyme-Loaded Polymeric Stealth Coating-Armed Engineered Probiotics by Disrupting Tumor Lactate Homeostasis to Synergistic Metabolism-Immuno-Enzyme Dynamic Therapy

Authors - Liuzhou Mao
IF

Adv Sci (Weinh)

Mitochondria-Targeted ROS Scavenging Natural Enzyme Cascade Nanogels for Periodontitis Treatment via Hypoxia Alleviation and Immunomodulation

Authors - Yanfen Zheng

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Rachel (Verified Customer) (08-09-2022)

This ab works really well for IF in murine liver samples (formalin-fixed).

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:100
  • Cell Tissue Type: Mouse liver
Loading...
||
New chat Able
正在加载,请稍候...