Tested Applications
| Positive IF/ICC detected in | HepG2 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
CL594-66129 targets Arginase-1 in IF/ICC applications and shows reactivity with human, mouse, rat, pig samples.
| Tested Reactivity | human, mouse, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag8810 Product name: Recombinant human ARG1 protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 1-236 aa of BC005321 Sequence: MSAKSRTIGIIGAPFSKGQPRGGVEEGPTVLRKAGLLEKLKEQECDVKDYGDLPFADIPNDSPFQIVKNPRSVGKASEQLAGKVAEVKKNGRISLVLGGDHSLAIGSISGHARVHPDLGVIWVDAHTDINTPLTTTSGNLHGQPVSFLLKELKGKIPDVPGFSWVTPCISAKDIVYIGLRDVDPGEHYILKTLGIKYFSMTEVTRTVNTAVAITLACFGLAREGNHKPIDYLNPPK Predict reactive species |
| Full Name | arginase, liver |
| Calculated Molecular Weight | 236aa,25 kDa; 322aa,35 kDa |
| GenBank Accession Number | BC005321 |
| Gene Symbol | Arginase-1 |
| Gene ID (NCBI) | 383 |
| RRID | AB_2883522 |
| Conjugate | CoraLite®594 Fluorescent Dye |
| Excitation/Emission Maxima Wavelengths | 588 nm / 604 nm |
| Excitation Laser | Yellow-Green Laser (561 nm) |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P05089 |
| Storage Buffer | PBS with 50% glycerol, 0.05% Proclin300, 0.5% BSA, pH 7.3. |
| Storage Conditions | Store at -20°C. Avoid exposure to light. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. |
Background Information
Arginase-1 (Liver arginase) belongs to the arginase family. ARG1 is a novel immunohistochemical marker of hepatocellular differentiation in fine needle aspiration cytology and a marker of hepatocytes and hepatocellular neoplasms. ARG1 is closely associated with alternative macrophage activation(PMID:12098359) and ARG1 has been shown to protectmotor neurons from trophic factor deprivation and allow sensory neurons to overcome neurite outgrowth inhibition by myelin proteins(PMID: 20071539).It can exsit as a homotrimer(PMID:16141327) and it has 3 isoforms produced by alternative splicing.Defects in ARG1 are the cause of argininemia (ARGIN). Deletion or TNF-mediated restriction of ARG1 unleashes the production of NO by NOS2, which is critical for pathogen control.(PMID:27117406). ARG1 is a novel biomarker of post-stroke immune suppression(2016). The antibody is conjugated with CL594, Ex/Em 593 nm/614 nm.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for CL594 Arginase-1 antibody CL594-66129 | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
CL594-66129 is the CoraLite®594-conjugated Arginase-1 Monoclonal antibody (clone 5D6D12). It has 8 citations published in ACS Nano, Advanced Science, and British Journal of Pharmacology. The research fields span nanomedicine, inflammatory diseases (acute pancreatitis, periodontitis, acute lung injury), immunomodulation, macrophage polarization, metabolic dysfunction-associated fatty liver disease, and ferroptosis in steatohepatitis.
| Species | Application | Title |
|---|---|---|
ACS Nano Biomimetic Trypsin-Responsive Structure-Bridged Mesoporous Organosilica Nanomedicine for Precise Treatment of Acute Pancreatitis | ||
Adv Sci (Weinh) Natural Enzyme-Loaded Polymeric Stealth Coating-Armed Engineered Probiotics by Disrupting Tumor Lactate Homeostasis to Synergistic Metabolism-Immuno-Enzyme Dynamic Therapy | ||
Adv Sci (Weinh) Mitochondria-Targeted ROS Scavenging Natural Enzyme Cascade Nanogels for Periodontitis Treatment via Hypoxia Alleviation and Immunomodulation | ||
Adv Sci (Weinh) A Pathology-Instructed Theranostic Platform with Mechanoadaptive and ROS-Powered Nanobreathing Functions for Precision Myocardial Repair. | ||
Adv Sci (Weinh) Wireless Localized Electrical Stimulation Generated by an Ultrasound-Driven Piezoelectric Discharge Regulates Proinflammatory Macrophage Polarization. | ||
Adv Sci (Weinh) ROS-Driven Nanoventilator for MRSA-Induced Acute Lung Injury Treatment via In Situ Oxygen Supply, Anti-Inflammation and Immunomodulation |
Reviews
What customers say
One customer review is available for this product. Rachel Bell (2022) gave it a 5-star rating after using it at a 1:100 dilution for immunofluorescence on formalin-fixed mouse liver tissue. She reported that the antibody "works really well" for this application, indicating strong performance and reliability in her hands.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Rachel (Verified Customer) (08-09-2022) | This ab works really well for IF in murine liver samples (formalin-fixed).
|
