ARHGAP19 Polyclonal antibody

• 

  WB analysis of MCF-7 using 31092-1-AP

  WB result of ARHGAP19 antibody (31092-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ARHGAP19 transfected MCF-7 cells.

• 

  WB analysis using 31092-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31092-1-AP (ARHGAP19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

ARHGAP19 Polyclonal Antibody for WB, ELISA

Cat No. 31092-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

Rho GTPase-activating protein 19, Rho-type GTPase-activating protein 19

---

Tested Applications

• Positive WB detected in: HL-60 cells, MCF-7 cells, Jurkat cells, K-562 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31092-1-AP targets ARHGAP19 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34671

  Product name: Recombinant human ARHGAP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-494 aa of BC114490

  Sequence: KKKQLIRQFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL

• Full Name: Rho GTPase activating protein 19
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC114490
• Gene Symbol: ARHGAP19
• Gene ID (NCBI): 84986
• RRID: AB_3669850
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14CB8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.