ARHGAP19 Polyclonal antibody, PBS Only

• 

  WB analysis using 31092-1-AP (same clone as 31092-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31092-1-AP (ARHGAP19 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31092-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 31092-1-AP (same clone as 31092-1-PBS)

  WB result of ARHGAP19 antibody (31092-1-AP; 1:1000; incubated at room temperature for 1.5 hours) with sh-Control and sh-ARHGAP19 transfected MCF-7 cells. This data was developed using the same antibody clone with 31092-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARHGAP19 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31092-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

Rho GTPase-activating protein 19, Rho-type GTPase-activating protein 19

---

Product Information

31092-1-PBS targets ARHGAP19 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag34671

  Product name: Recombinant human ARHGAP19 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 388-494 aa of BC114490

  Sequence: KKKQLIRQFNKQSLTQTPGREPSTSQVQKRARSRSFSGLIKRKVLGNQMMSEKKKKNPTPESVAIGELKGTSKENRNLLFSGSPAVTMTPTRLKWSEGKKEGKKGFL

• Full Name: Rho GTPase activating protein 19
• Observed Molecular Weight: 54 kDa
• GenBank Accession Number: BC114490
• Gene Symbol: ARHGAP19
• Gene ID (NCBI): 84986
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q14CB8
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.