ARID1A Polyclonal antibody

• 

  WB analysis using 30304-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 30304-1-AP (ARID1A antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 30304-1-AP

  IP result of anti-ARID1A (IP:30304-1-AP, 4ug; Detection:30304-1-AP 1:3000) with HeLa cells lysate 1280 ug.

• 

  IHC staining of human endometrial cancer using 30304-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 30304-1-AP (ARID1A antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 30304-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 30304-1-AP (ARID1A antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 30304-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 30304-1-AP (ARID1A antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human endometrial cancer using 30304-1-AP

  Immunohistochemical analysis of paraffin-embedded human endometrial cancer tissue slide using 30304-1-AP (ARID1A antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ARID1A Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 30304-1-AP

Publications(1)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, ELISA

Synonyms

BM029, BAF250A, BAF250, B120, AT-rich interactive domain-containing protein 1A

---

Tested Applications

• Positive WB detected in: HeLa cells, HepG2 cells, K-562 cells, MCF-7 cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human endometrial cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:12000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

30304-1-AP targets ARID1A in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30749

  Product name: Recombinant human ARID1A protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1230-1370 aa of NM_006015

  Sequence: KDPYGSMRKAPGSDPFMSSGQGPNGGMGDPYSRAAGPGLGNVAMGPRQHYPYGGPYDRVRTEPGIGPEGNMSTGAPQPNLMPSNPDSGMYSPSRYPPQQQQQQQQRHDSYGNQFSTQGTPSGSPFPSQQTTMYQQQQQNYK

• Full Name: AT rich interactive domain 1A (SWI-like)
• Calculated Molecular Weight: 242 kDa
• Observed Molecular Weight: 250-260 kDa
• GenBank Accession Number: NM_006015
• Gene Symbol: ARID1A
• Gene ID (NCBI): 8289
• RRID: AB_3086292
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O14497
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ARID1A, also named as BAF250, BAF250A, C1orf4, OSA1 and SMARCF1, is involved in transcriptional activation and repression of select genes by chromatin remodeling (alteration of DNA-nucleosome topology). It binds DNA non-specifically. It is also involved in vitamin D-coupled transcription regulation via its association with the WINAC complex, a chromatin-remodeling complex recruited by vitamin D receptor (VDR), which is required for the ligand-bound VDR-mediated transrepression of the CYP27B1 gene. ARID1A belongs to the neural progenitors-specific chromatin remodeling complex (npBAF complex) and the neuron-specific chromatin remodeling complex (nBAF complex). During neural development a switch from a stem/progenitor to a post-mitotic chromatin remodeling mechanism occurs as neurons exit the cell cycle and become committed to their adult state. The antibody is specific to ARID1A.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Acta Biomater; Effective Delivery of CRISPR/dCas9-SAM for Multiplex Gene Activation Based on Mesoporous Silica Nanoparticles for Bladder Cancer Therapy; Authors - Jinming Xu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Roy (Verified Customer) (06-15-2024)

Great antibody that detects ARID1A by WB from HeLa extracts (1/1000 dilution, 1h at room temperature)

• Applications: Western Blot
• Primary Antibody Dilution: 1/1000
• Cell Tissue Type: HeLa