Tested Applications
| Positive WB detected in | MCF-7 cells, A549 cells, K-562 cells |
| Positive IP detected in | MCF-7 cells |
| Positive IHC detected in | human pancreas cancer tissue, human breast cancer tissue, human cervical cancer tissue, human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:500-1:2000 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:200-1:800 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 1 publications below |
| WB | See 5 publications below |
| IP | See 1 publications below |
Product Information
24499-1-AP targets ARID4B in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21462 Product name: Recombinant human ARID4B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 406-523 aa of BC130418 Sequence: MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE Predict reactive species |
| Full Name | AT rich interactive domain 4B (RBP1-like) |
| Calculated Molecular Weight | 1312 aa, 148 kDa |
| Observed Molecular Weight | 100 kDa, 200 kDa |
| GenBank Accession Number | BC130418 |
| Gene Symbol | ARID4B |
| Gene ID (NCBI) | 51742 |
| RRID | AB_2879575 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q4LE39 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARID4B, also named as BRCAA1 or SAP180, is a 1312 amino acid protein, which contains one ARID domain. ARID4B localizes in the nucleus and cytoplasm. ARID4B as a transcription repressor may function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. ARID4B is highly expressed in the testis and in breast, lung, colon, pancreatic and ovarian cancers. Expressed at low levels in the thymus, prostate and ovary.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ARID4B antibody 24499-1-AP | Download protocol |
| IHC protocol for ARID4B antibody 24499-1-AP | Download protocol |
| IP protocol for ARID4B antibody 24499-1-AP | Download protocol |
| WB protocol for ARID4B antibody 24499-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
J Clin Invest The FOXN3-NEAT1-SIN3A repressor complex promotes progression of hormonally responsive breast cancer. | ||
Theranostics SLC14A1 prevents oncometabolite accumulation and recruits HDAC1 to transrepress oncometabolite genes in urothelial carcinoma. | ||
Cell Death Dis DNA-methylation-mediated silencing of miR-486-5p promotes colorectal cancer proliferation and migration through activation of PLAGL2/IGF2/β-catenin signal pathways. | ||
Br J Nutr Taurine stimulates protein synthesis and proliferation of C2C12 myoblast cells through the PI3K-ARID4B-mTOR pathway.
| ||
Cancer Lett Forkhead Box Protein FOXK1 Disrupts the Circadian Rhythm to Promote Breast Tumorigenesis in Response to Insulin Resistance |





















