ARID4B Monoclonal antibody, PBS Only

• 

  WB analysis of T-47D using 67384-1-Ig (same clone as 67384-1-PBS)

  T-47D cells were subjected to SDS PAGE followed by western blot with 67384-1-Ig (ARID4B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67384-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MDA-MB-231 using 67384-1-Ig (same clone as 67384-1-PBS)

  MDA-MB-231 cells were subjected to SDS PAGE followed by western blot with 67384-1-Ig (ARID4B antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67384-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67384-1-Ig (same clone as 67384-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67384-1-Ig (ARID4B antibody) at dilution of 1:1000 (under 0x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67384-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 67384-1-Ig (same clone as 67384-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 67384-1-Ig (ARID4B antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 67384-1-PBS in a different storage buffer formulation.

ARID4B Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67384-1-PBS

Clone No.1H3E2

Host / Isotype

Mouse / IgG1

Reactivity

Human

Applications

WB, Indirect ELISA

Synonyms

ARID4B, BRCAA1, DKFZp313M2420, RBBP1L1, RBP1L1, SAP180

---

Product Information

67384-1-PBS targets ARID4B in WB, Indirect ELISA applications and shows reactivity with Human samples.

• Tested Reactivity: Human
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag21485

  Product name: Recombinant human ARID4B protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 406-523 aa of BC130418

  Sequence: MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE

• Full Name: AT rich interactive domain 4B (RBP1-like)
• Calculated Molecular Weight: 1312 aa, 148 kDa
• GenBank Accession Number: BC130418
• Gene Symbol: ARID4B
• Gene ID (NCBI): 51742
• RRID: AB_2918489
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q4LE39
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ARID4B, also named as BRCAA1 or SAP180, is a 1312 amino acid protein, which contains one ARID domain. ARID4B localizes in the nucleus and cytoplasm. ARID4B as a transcription repressor may function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. ARID4B is highly expressed in the testis and in breast, lung, colon, pancreatic and ovarian cancers. Expressed at low levels in the thymus, prostate and ovary.