Product Information
67384-1-PBS targets ARID4B in WB, Indirect ELISA applications and shows reactivity with Human samples.
| Tested Reactivity | Human |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag21485 Product name: Recombinant human ARID4B protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 406-523 aa of BC130418 Sequence: MALPEKVVNKQCKECENVKEIKVKEENETEIKEIKMEEERNIIPREEKPIEDEIERKENIKPSLGSKKNLLESIPTHSDQEKEVNIKKPEDNENLDDKDDDTTRVDESLNIKVEAEEE Predict reactive species |
| Full Name | AT rich interactive domain 4B (RBP1-like) |
| Calculated Molecular Weight | 1312 aa, 148 kDa |
| GenBank Accession Number | BC130418 |
| Gene Symbol | ARID4B |
| Gene ID (NCBI) | 51742 |
| RRID | AB_2918489 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | Q4LE39 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ARID4B, also named as BRCAA1 or SAP180, is a 1312 amino acid protein, which contains one ARID domain. ARID4B localizes in the nucleus and cytoplasm. ARID4B as a transcription repressor may function in the assembly and/or enzymatic activity of the Sin3A corepressor complex or in mediating interactions between the complex and other regulatory complexes. ARID4B is highly expressed in the testis and in breast, lung, colon, pancreatic and ovarian cancers. Expressed at low levels in the thymus, prostate and ovary.







