Tested Applications
| Positive WB detected in | Jurkat cells, human placenta tissue |
| Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
16956-1-AP targets ARL6IP6 in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag10598 Product name: Recombinant human ARL6IP6 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC028741 Sequence: MSFAESGWRSALRRRGPGTPGPVARPSYSSFTQGDSWGEGEVDEEEGCDQVARDLRAEFSAGAWSEPRKRSVLPPDGNGSPVLPDKRNGIFPAAAGSRAQPRRWPVQVLS Predict reactive species |
| Full Name | ADP-ribosylation-like factor 6 interacting protein 6 |
| Calculated Molecular Weight | 226 aa, 25 kDa |
| Observed Molecular Weight | 23-25 kDa |
| GenBank Accession Number | BC028741 |
| Gene Symbol | ARL6IP6 |
| Gene ID (NCBI) | 151188 |
| RRID | AB_2058995 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8N6S5 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ARL6IP6 antibody 16956-1-AP | Download protocol |
| WB protocol for ARL6IP6 antibody 16956-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







