Tested Applications
Positive WB detected in | mouse brain tissue |
Positive IP detected in | fetal human brain |
Positive IHC detected in | human ovary cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 5 publications below |
Product Information
25705-1-AP targets ARMCX3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, mouse, monkey |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag22501 Product name: Recombinant human ARMCX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 38-145 aa of BC005194 Sequence: MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIA Predict reactive species |
Full Name | armadillo repeat containing, X-linked 3 |
Calculated Molecular Weight | 379 aa, 43 kDa |
Observed Molecular Weight | 40 kDa |
GenBank Accession Number | BC005194 |
Gene Symbol | ARMCX3 |
Gene ID (NCBI) | 51566 |
RRID | AB_2880201 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UH62 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARMCX3, also named as Armadillo repeat-containing X-linked protein 3, is a 379 amino acid protein, which contains 3 ARM repeats. ARMCX3 is a single pass membrane protein belonging to the armadillo repeat family of proteins. ARMCX3 is believed to play a role in embryonic development and tissue maintenance and may also function as a tumor suppressor.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ARMCX3 antibody 25705-1-AP | Download protocol |
IHC protocol for ARMCX3 antibody 25705-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Cell Biol MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control.
| ||
Sci Signal A mammalian-specific Alex3/Gαq protein complex regulates mitochondrial trafficking, dendritic complexity, and neuronal survival
| ||
Cancers (Basel) ARMCX3 Mediates Susceptibility to Hepatic Tumorigenesis Promoted by Dietary Lipotoxicity. | ||
Int J Obes (Lond) The armadillo-repeat containing X-linked protein 3, ARMCX3, is a negative regulator of the browning of adipose tissue associated with obesity. | ||
Heliyon ARMCX3 regulates ROS signaling, affects neural differentiation and inflammatory microenvironment in dental pulp stem cells |