Tested Applications
| Positive WB detected in | mouse brain tissue |
| Positive IP detected in | fetal human brain |
| Positive IHC detected in | human ovary cancer tissue, rat ovary tissue, rat epididymis tissue, human placenta tissue, mouse epididymis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
25705-1-AP targets ARMCX3 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, monkey |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag22501 Product name: Recombinant human ARMCX3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 38-145 aa of BC005194 Sequence: MAEGGSGDVDDAGDCSGARYNDWSDDDDDSNESKSIVWYPPWARIGTEAGTRARARARARATRARRAVQKRASPNSDDTVLSPQELQKVLCLVEMSEKPYILEAALIA Predict reactive species |
| Full Name | armadillo repeat containing, X-linked 3 |
| Calculated Molecular Weight | 379 aa, 43 kDa |
| Observed Molecular Weight | 40 kDa |
| GenBank Accession Number | BC005194 |
| Gene Symbol | ARMCX3 |
| Gene ID (NCBI) | 51566 |
| RRID | AB_2880201 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UH62 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ARMCX3, also named as Armadillo repeat-containing X-linked protein 3, is a 379 amino acid protein, which contains 3 ARM repeats. ARMCX3 is a single pass membrane protein belonging to the armadillo repeat family of proteins. ARMCX3 is believed to play a role in embryonic development and tissue maintenance and may also function as a tumor suppressor.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ARMCX3 antibody 25705-1-AP | Download protocol |
| WB protocol for ARMCX3 antibody 25705-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The ARMCX3 antibody (Cat# 25705-1-AP) has 5 total citations published in Nature Cell Biology, Science Signaling, International Journal of Obesity, Cancers (Basel), and Heliyon. Research fields span mitochondrial biology and vesicle biogenesis, neuronal trafficking and survival, adipose tissue browning and obesity, hepatic tumorigenesis, and neural differentiation in dental pulp stem cells. All cited applications are Western blot, with species including monkey, mouse, and human.
| Species | Application | Title |
|---|---|---|
Nat Cell Biol MIROs and DRP1 drive mitochondrial-derived vesicle biogenesis and promote quality control.
| ||
Sci Signal A mammalian-specific Alex3/Gαq protein complex regulates mitochondrial trafficking, dendritic complexity, and neuronal survival
| ||
Int J Obes (Lond) The armadillo-repeat containing X-linked protein 3, ARMCX3, is a negative regulator of the browning of adipose tissue associated with obesity. | ||
Cancers (Basel) ARMCX3 Mediates Susceptibility to Hepatic Tumorigenesis Promoted by Dietary Lipotoxicity. | ||
Heliyon ARMCX3 regulates ROS signaling, affects neural differentiation and inflammatory microenvironment in dental pulp stem cells |
