ARPC2 Polyclonal antibody, PBS Only

• 

  WB analysis using 15058-1-AP (same clone as 15058-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 15058-1-AP (same clone as 15058-1-PBS)

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15058-1-AP (same clone as 15058-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15058-1-AP (same clone as 15058-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 15058-1-AP (same clone as 15058-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 15058-1-AP (same clone as 15058-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 15058-1-AP (same clone as 15058-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 3T3-L1 using 15058-1-AP (same clone as 15058-1-PBS)

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of PC-3 using 15058-1-AP (same clone as 15058-1-PBS)

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 15058-1-AP (same clone as 15058-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 15058-1-AP (same clone as 15058-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 15058-1-AP (same clone as 15058-1-PBS)

  IP result of anti-ARPC2 (IP:15058-1-AP, 4ug; Detection:15058-1-AP 1:6000) with HeLa cells lysate 1200 ug. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15058-1-AP (same clone as 15058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 15058-1-AP (same clone as 15058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 15058-1-AP (same clone as 15058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 15058-1-AP (same clone as 15058-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 15058-1-AP (same clone as 15058-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ARPC2 antibody (15058-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• 

  FC experiment of HeLa using 15058-1-AP (same clone as 15058-1-PBS)

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ARPC2 (15058-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer. This data was developed using the same antibody clone with 15058-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ARPC2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Cat No. 15058-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA

Synonyms

Actin-related protein 2/3 complex subunit 2, ARC34, p34 Arc, p34-ARC

---

Product Information

15058-1-PBS targets ARPC2 in WB, IHC, IF/ICC, FC (Intra), IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7041

  Product name: Recombinant human ARPC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC000590

  Sequence: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

• Full Name: actin related protein 2/3 complex, subunit 2, 34kDa
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC000590
• Gene Symbol: ARPC2
• Gene ID (NCBI): 10109
• RRID: AB_2059787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15144
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.