ARPC2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ARPC2 Polyclonal antibody (15058-1-AP)

• Featured Product
• KD/KO Validated

ARPC2 Polyclonal Antibody for WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Cat No. 15058-1-AP Copied!

Publications (12)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, FC (Intra), IP, ELISA

Synonyms

Actin-related protein 2/3 complex subunit 2, ARC34, p34 Arc, p34-ARC

• 

  WB analysis using 15058-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MCF-7 using 15058-1-AP

  MCF7 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15058-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15058-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 15058-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of mouse skeletal muscle using 15058-1-AP

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 15058-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of 3T3-L1 using 15058-1-AP

  3T3-L1 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of PC-3 using 15058-1-AP

  PC-3 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of HeLa using 15058-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of NIH/3T3 using 15058-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 15058-1-AP (ARPC2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IP experiment of HeLa using 15058-1-AP

  IP result of anti-ARPC2 (IP:15058-1-AP, 4ug; Detection:15058-1-AP 1:6000) with HeLa cells lysate 1200 ug.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15058-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 15058-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of mouse brain using 15058-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:800 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human colon using 15058-1-AP

  Immunohistochemical analysis of paraffin-embedded human normal colon slide using 15058-1-AP (ARPC2 antibody) at dilution of 1:800 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IF Staining of HeLa using 15058-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using ARPC2 antibody (15058-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of HeLa using 15058-1-AP

  1X10^6 HeLa cells were intracellularly stained with 0.4 ug Anti-Human ARPC2 (15058-1-AP) and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) at dilution 1:1000 (red), or 0.4 ug Isotype Control. Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ARPC2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: HT-1080 cells, HeLa cells, mouse skeletal muscle tissue, PC-3 cells, 3T3-L1 cells, NIH/3T3 cells, MCF-7 cells, Jurkat cells
• Positive IP detected in: HeLa cells
• Positive IHC detected in: human breast cancer tissue, human colon tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells
• Positive FC (Intra) detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15058-1-AP targets ARPC2 in WB, IHC, IF/ICC, FC (Intra), IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7041

  Product name: Recombinant human ARPC2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-300 aa of BC000590

  Sequence: MILLEVNNRIIEETLALKFENAAAGNKPEAVEVTFADFDGVLYHISNPNGDKTKVMVSISLKFYKELQAHGADELLKRVYGSFLVNPESGYNVSLLYDLENLPASKDSIVHQAGMLKRNCFASVFEKYFQFQEEGKEGENRAVIHYRDDETMYVESKKDRVTVVFSTVFKDDDDVVIGKVFMQEFKEGRRASHTAPQVLFSHREPPLELKDTDAAVGDNIGYITFVLFPRHTNASARDNTINLIHTFRDYLHYHIKCSKAYIHTRMRAKTSDFLKVLNRARPDAEKKEMKTITGKTFSSR

• Full Name: actin related protein 2/3 complex, subunit 2, 34kDa
• Calculated Molecular Weight: 34 kDa
• Observed Molecular Weight: 34 kDa
• GenBank Accession Number: BC000590
• Gene Symbol: ARPC2
• Gene ID (NCBI): 10109
• RRID: AB_2059787
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O15144
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

ARPC2 Polyclonal antibody (Cat# 15058-1-AP) has 12 citations published in journals including Autophagy, Redox Biology, Developmental Cell, Cell Reports, Genes & Development, EMBO Reports, Journal of Cell Biology, Journal of Neuroscience, International Journal of Oncology, Frontiers in Cell and Developmental Biology, and Journal for ImmunoTherapy of Cancer. Research fields span actin cytoskeleton dynamics, autophagy, cancer progression (breast, colorectal, gastric), cell migration, mechanotransduction, oocyte biology, and neurobiology.

Automatically generated from the 12 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human,mouse	WB,IF	Autophagy; CORO1C (coronin 1C) promotes autophagosome formation by coordinating branched actin network dynamics; Authors - Guozhong Zhang
mouse	WB	Redox Biol; Coronin 1a-mediated F-actin disassembly controls effector function in murine neutrophils; Authors - Anton Shaverskyi
mouse	WB	Dev Cell; Aberrant cortex contractions impact mammalian oocyte quality; Authors - Elvira Nikalayevich
human	WB	Dev Cell; Vimentin intermediate filaments coordinate actin stress fibers and podosomes to determine the extracellular matrix degradation by macrophages; Authors - Xinyi Huang
human	WB	Cell Rep; Substrate rigidity dictates colorectal tumorigenic cell stemness and metastasis via CRAD-dependent mechanotransduction.; Authors - Yuhan Chang
	WB	Genes Dev; Localization of Kif1c mRNA to cell protrusions dictates binding partner specificity of the encoded protein; Authors - Megan L Norris