ASB14 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASB14 Polyclonal antibody (25300-1-AP)

ASB14 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 25300-1-AP Copied!

Publications (1)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

ASB 14, ASB-14

• 

  WB analysis using 25300-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 25300-1-AP (ASB14 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 25300-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25300-1-AP (ASB14 Antibody) at dilution of 1:50 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human tonsillitis using 25300-1-AP

  Immunohistochemical analysis of paraffin-embedded human tonsillitis tissue slide using 25300-1-AP (ASB14 Antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ASB14 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: Jurkat cells, Raji cells, mouse spleen tissue, rat spleen tissue
• Positive IHC detected in: human tonsillitis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

25300-1-AP targets ASB14 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18147

  Product name: Recombinant human ASB14 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 366-478 aa of BC114953

  Sequence: SNSDLSSVKLLLSAGALPNQDPVNCLQIALRMGNYELISLLLRHGANVNYFCRVNPLHFPSALQYTLKDEVMLRMLLNYGYDTERCFDCPHGDKVHPSYTVEGWTSTVIKDTK

• Full Name: ankyrin repeat and SOCS box-containing 14
• Calculated Molecular Weight: 587 aa, 65 kDa
• Observed Molecular Weight: 65 kDa
• GenBank Accession Number: BC114953
• Gene Symbol: ASB14
• Gene ID (NCBI): 142686
• RRID: AB_2880017
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: A6NK59
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The ASB14 antibody (catalog #25300-1-AP) has 1 total citation, published in FASEB Journal (2025). The associated research field is mitochondrial biology and cardiology, specifically integrating multiomics approaches to reveal and validate key proteins, metabolites, and pathways of ASB14 affecting mitochondrial function in human cardiomyocytes (AC16 cells). The antibody was applied in Western Blot.

Automatically generated from the 1 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	FASEB J; Integrating Multiomics to Reveal and Validate Key Proteins, Metabolites, and Pathways of ASB14 Affecting Mitochondrial Function in Cardiomyocytes AC16; Authors - Che Wang