ASC/TMS1 Polyclonal antibody, PBS Only

• 

  WB analysis using 10500-1-AP (same clone as 10500-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:15000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10500-1-AP (same clone as 10500-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 10500-1-AP (same clone as 10500-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:6000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  WB analysis of A549 using 10500-1-AP (same clone as 10500-1-PBS)

  A549 cells were subjected to SDS PAGE followed by western blot with 10500-1-AP (TMS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 10500-1-AP (same clone as 10500-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 10500-1-AP (TMS1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HL-60 using 10500-1-AP (same clone as 10500-1-PBS)

  IP result of anti-ASC/TMS1 (IP:10500-1-AP, 4ug; Detection:10500-1-AP 1:10000) with HL-60 cells lysate 2240 ug. This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10500-1-AP (same clone as 10500-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10500-1-AP (same clone as 10500-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10500-1-AP (same clone as 10500-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (ASC/TMS1 antibody) at dilution of 1:1000 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 10500-1-AP (same clone as 10500-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 10500-1-AP (TMS1 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• 

  IF Staining of MCF-7 using 10500-1-AP (same clone as 10500-1-PBS)

  Immunofluorescent analysis of (-20℃ Ethanol) fixed MCF-7 cells using 10500-1-AP (TMS1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 10500-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ASC/TMS1 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 10500-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

PYCARD, hASC, Caspase recruitment domain-containing protein 5, CARD5, ASC

---

Product Information

10500-1-PBS targets ASC/TMS1 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0774

  Product name: Recombinant human TMS1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-135 aa of BC004470

  Sequence: MGRARDAILDALENLTAEELKKFKLQAATHQGSGAAPAGIQAPPQSAAKPGLHFIDQHRAALIARVTNVEWLLDALYGKVLTDEQYQAVRAEPTNPSKMRKLFSFTPAWNWTCKDLLLQALRESQSYLVEDLERS

• Full Name: PYD and CARD domain containing
• Calculated Molecular Weight: 25 kDa
• Observed Molecular Weight: 22-25 kDa
• GenBank Accession Number: BC004470
• Gene Symbol: ASC/TMS1
• Gene ID (NCBI): 29108
• RRID: AB_2174862
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9ULZ3
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

PYCARD , also known as ASC or TMS1, is a 195 amino acid protein containing an N-terminal Pyrin-like domain (PYD) and an 87 residue C-terminal Caspase-associated recruitment domain (CARD). It promotes caspase-mediated apoptosis which is mediated predominantly through the activation of caspase-9.