ASCL2 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• ASCL2 Polyclonal antibody (21368-1-AP)

ASCL2 Polyclonal Antibody for WB, ELISA

Cat No. 21368-1-AP Copied!

Publications (6)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human and More (2)

Applications

WB, IF, ChIP, ELISA

Synonyms

Achaete scute homolog 2, Achaete-scute homolog 2, ASH2, ASH-2, bHLHa45

• 

  WB analysis of Caco-2 using 21368-1-AP

  Caco-2 cells were subjected to SDS PAGE followed by western blot with 21368-1-AP (ASCL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis of MKN-45 using 21368-1-AP

  MKN-45 cells were subjected to SDS PAGE followed by western blot with 21368-1-AP (ASCL2 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for ASCL2 in ?

Chat with Able

---

Tested Applications

• Positive WB detected in: MKN-45 cells, Caco-2 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

21368-1-AP targets ASCL2 in WB, IF, ChIP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag15839

  Product name: Recombinant human ASCL2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 102-193 aa of BC057801

  Sequence: LQRLLAEHDAVRNALAGGLRPQAVRPSAPRGPPGTTPVAASPSRASSSPGRGGSSEPGSPRSAYSSDDSGCEGALSPAERELLDFSSWLGGY

• Full Name: achaete-scute complex homolog 2 (Drosophila)
• Calculated Molecular Weight: 193 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC057801
• Gene Symbol: ASCL2
• Gene ID (NCBI): 430
• RRID: AB_2935452
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99929
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Achaete-scute complex homolog 2 (Drosophila), also known as ASCL2, is an imprinted human gene. This gene is involved in the determination of the neuronal precursors in the peripheral nervous system and the central nervous system, particularly important during implantation of the developing embryo, specifically in placental development and neuronal precursor determination. ASCL2 has been reported involved in tumor progression, being upregulated in colorectal tumors, and involvement in metastasis could be attributed to ASCL2-promoted cellular self-renewal as opposed to cellular differentiation (PMID: 30096149 16568095).

Publications

What published studies show

The ASCL2 Polyclonal antibody (Cat# 21368-1-AP) has 6 citations published in Advanced Science, Cell Oncology, Biomedicines, Journal of Biochemical and Molecular Toxicology, Gene, and IMetaOmics. Research fields span oncology (colorectal cancer metastasis, pancreatic cancer stemness and progression), tumor metabolism (fatty acid oxidation inhibition for antitumor therapy), inflammatory bowel disease (cold exposure alleviating colitis), and intestinal microenvironment (serotonin synthesis effects on colonic ecology). Applications cited include WB, ChIP, and IF in human, mouse, and rat samples.

Automatically generated from the 6 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Adv Sci (Weinh); Inhibiting FAT1 Blocks Metabolic Bypass to Enhance Antitumor Efficacy of TCA Cycle Inhibition through Suppressing CPT1A-Dependent Fatty Acid Oxidation; Authors - Fanghui Chen
human	WB,ChIP	Cell Oncol (Dordr); ASCL2 drives colorectal cancer metastasis through transcriptional activation of TDGF1.; Authors - Defu Li ; KD Validated
mouse	WB	Biomedicines; Cold Exposure Alleviates Colitis via Parallel Integration of Colonic Mucosal Regeneration and Ileal Antimicrobial Defense.; Authors - Yuzhu Di
human	WB	J Biochem Mol Toxicol; Mechanism of Cancer-Associated Fibroblasts-Derived NEAT1 Promoting Pancreatic Cancer Cell Stemness via the miR-101-3p/KDM3A Axis.; Authors - Jian Li
human	WB	Gene; tRNA-derived RNA fragment, tRF-18-8R6546D2, promotes pancreatic adenocarcinoma progression by directly targeting ASCL2; Authors - Sihua Lan
rat	IF	IMetaOmics; Integrated omics revealed the altered colonic microenvironment after inhibition of peripheral serotonin synthesis by LP533401.; Authors - Yidan Ling