Product Information
85848-4-PBS targets ASF1B in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag17763 Product name: Recombinant human ASF1B protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 151-202 aa of BC010014 Sequence: INWDNNMDRLEAIETQDPSLGCGLPLNCTPIKGLGLPGCIPGLLPENSMDCI Predict reactive species |
| Full Name | ASF1 anti-silencing function 1 homolog B (S. cerevisiae) |
| Calculated Molecular Weight | 202 aa, 22 kDa |
| Observed Molecular Weight | 19 kDa |
| GenBank Accession Number | BC010014 |
| Gene Symbol | ASF1B |
| Gene ID (NCBI) | 55723 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | Q9NVP2 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
ASF1B is a member of the H3/H4 family of histone chaperone proteins and is similar to the anti-silencing function-1 gene in yeast. The encoded protein is the substrate of the tousled-like kinase family of cell cycle-regulated kinases and may play a key role in modulating the nucleosome structure of chromatin by ensuring a constant supply of histones at sites of nucleosome assembly. This antibody specifically reacts with the 19kd ASF1B protein.

