Tested Applications
Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue |
Positive IP detected in | mouse brain tissue |
Positive IHC detected in | human pancreas cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 11 publications below |
IHC | See 4 publications below |
IF | See 3 publications below |
FC | See 2 publications below |
CoIP | See 2 publications below |
Product Information
27235-1-AP targets ASIC1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25941 Product name: Recombinant human ASIC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 464-528 aa of NM_001095 Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC Predict reactive species |
Full Name | amiloride-sensitive cation channel 2, neuronal |
Calculated Molecular Weight | 60 kDa |
Observed Molecular Weight | 60-70 kDa, 80-90 kDa |
GenBank Accession Number | NM_001095 |
Gene Symbol | ASIC1 |
Gene ID (NCBI) | 41 |
RRID | AB_2880814 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P78348 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel/degenerin (ENaC/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084).
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ASIC1 antibody 27235-1-AP | Download protocol |
IHC protocol for ASIC1 antibody 27235-1-AP | Download protocol |
IP protocol for ASIC1 antibody 27235-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Research (Wash D C) Targeting ASIC1a Promotes Neural Progenitor Cell Migration and Neurogenesis in Ischemic Stroke | ||
Int Immunopharmacol ASIC1a regulates airway epithelial cell pyroptosis in acute lung injury by NLRP3-Caspase1-GSDMD pathway | ||
Cell Signal Paeoniflorin inhibits pyroptosis of nucleus pulposus cells in an acidic environment and alleviates the degeneration of the intervertebral disc in rats | ||
Lab Invest Acidosis induces synovial fibroblasts to release vascular endothelial growth factor via acid-sensitive ion channel 1a. | ||
Lab Invest ASIC1a promotes the proliferation of synovial fibroblasts via the ERK/MAPK pathway. | ||
Eur J Pharmacol The interaction of ASIC1a and ERS mediates nerve cell apoptosis induced by insulin deficiency.
|