Tested Applications
| Positive WB detected in | mouse brain tissue, mouse cerebellum tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human pancreas cancer tissue, mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:1000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27235-1-AP targets ASIC1 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag25941 Product name: Recombinant human ASIC1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 464-528 aa of NM_001095 Sequence: MKLCRRGKCQKEAKRSSADKGVALSLDDVKRHNPCESLRGHPAGMTYAANILPHHPARGTFEDFTC Predict reactive species |
| Full Name | amiloride-sensitive cation channel 2, neuronal |
| Calculated Molecular Weight | 60 kDa |
| Observed Molecular Weight | 60-70 kDa, 80-90 kDa |
| GenBank Accession Number | NM_001095 |
| Gene Symbol | ASIC1 |
| Gene ID (NCBI) | 41 |
| RRID | AB_2880814 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P78348 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ASIC1(Acid-sensing ion channel 1), also named as ACCN2, BNaC2 or amiloride-sensitive cation channel 2, is a member of the ASICs family. ASICs, an H+-gated subgroup of the epithelial Na+ channel/degenerin (ENaC/DEG) superfamily, are widely expressed throughout the central and peripheral nervous system and triggered by increased extracellular acidification (PMID: 28518134, 27941930). ASIC1 is a key player in acidosis-induced tumor growth and invasiveness. Clinically, alterations of ASIC1 are associated with poor survival in breast cancer (PMID: 26686084).
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for ASIC1 antibody 27235-1-AP | Download protocol |
| IP protocol for ASIC1 antibody 27235-1-AP | Download protocol |
| WB protocol for ASIC1 antibody 27235-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-ASIC1a (Cat# 27235-1-AP) has 19 citations published in journals including Journal of Advanced Research, Acta Pharmacologica Sinica, European Journal of Pharmacology, International Immunopharmacology, Translational Psychiatry, Apoptosis, Life Sciences, Biomolecules, Cell Signaling, Laboratory Investigation, Endocrinology, CNS Neuroscience & Therapeutics, Scientific Reports, and Journal of Orthopaedic Research. Research fields span atherosclerosis, acute lung injury, neuroinflammation, pyroptosis, intervertebral disc degeneration, liver disease, anxiety/depression, and rheumatoid arthritis.
| Species | Application | Title |
|---|---|---|
Research (Wash D C) Targeting ASIC1a Promotes Neural Progenitor Cell Migration and Neurogenesis in Ischemic Stroke | ||
Acta Pharmacol Sin Acid-sensing ion channel 1a promotes alcohol-associated liver disease in mice via regulating endoplasmic reticulum autophagy | ||
Apoptosis Mechanism of glycolysis-pyrolysis crosstalk driving vicious circle of intervertebral disc degeneration.
| ||
Transl Psychiatry The acid-sensing ion channel 1a modulates anxiety- and depression-related behaviors via its influencing on the activity of corticotropin-releasing hormone-expressing neurons in the hypothalamic paraventricular nucleus in male mice. | ||
CNS Neurosci Ther Inhibition of ASIC1a Attenuates Neuronal Pyroptosis and Neuroinflammation Following Traumatic Brain Injury. |
Reviews
What customers say
One reviewer used this antibody for Western Blot on liver tissue at a 1:1000 dilution (lot 00085406) and gave it a 5-star rating, describing it as "best suitable for WB." Overall, the single review reflects strong satisfaction with the product's performance in Western Blot applications.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
MALLIKARJUNA (Verified Customer) (10-24-2025) | BEST SUIATBLE FOR wb
|
