ASXL1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis using 84630-1-RR (same clone as 84630-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 84630-1-RR (ASXL1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 84630-1-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 84630-1-RR

  Biolayer interferometry (BLl) kinetic assays of 84630-1-RR against Human ASXL1 were performed. The affinity constant is 39.3 nM.

ASXL1 Uni-rAb^® Recombinant Antibody for WB, Indirect ELISA

Cat No. 84630-1-PBS

Clone No.241563A5

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

241563A5, Additional sex combs-like protein 1, KIAA0978, Polycomb group protein ASXL1

---

Product Information

84630-1-PBS targets ASXL1 in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag10290

  Product name: Recombinant human ASXL1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-84 aa of BC064984

  Sequence: MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR

• Full Name: additional sex combs like 1 (Drosophila)
• Calculated Molecular Weight: 84aa,10 kDa; 1541aa,165 kDa
• Observed Molecular Weight: 200-220 kDa
• GenBank Accession Number: BC064984
• Gene Symbol: ASXL1
• Gene ID (NCBI): 171023
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purfication
• UNIPROT ID: Q8IXJ9
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Additional sex combs-like 1 (ASXL1) is a member of the ASXL family, which is involved in epigenetic regulation. It is one of the mammalian Asx homologs. Mutations in the ASXL1 gene are frequently found in myeloid neoplasms, breast cancers, and prostate cancers (PMID: 30013160; PMID: 22436456; PMID: 26470845). In patients with myeloid malignancies, ASXL1 mutations are mostly heterozygous frameshift or nonsense mutations that result in C-terminal truncation (PMID: 30982744; PMID: 26095772; PMID: 32683582; PMID: 29643185).