Product Information
84630-1-PBS targets ASXL1 in WB, Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag10290 Product name: Recombinant human ASXL1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-84 aa of BC064984 Sequence: MKDKQKKKKERTWAEAARLVLENYSDAPMTPKQILQVIEAEGLKEMSGTSPLACLNAMLHSNSRGGEGLFYKLPGRISLFTLKR Predict reactive species |
| Full Name | additional sex combs like 1 (Drosophila) |
| Calculated Molecular Weight | 84aa,10 kDa; 1541aa,165 kDa |
| Observed Molecular Weight | 200-220 kDa |
| GenBank Accession Number | BC064984 |
| Gene Symbol | ASXL1 |
| Gene ID (NCBI) | 171023 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purfication |
| UNIPROT ID | Q8IXJ9 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
Additional sex combs-like 1 (ASXL1) is a member of the ASXL family, which is involved in epigenetic regulation. It is one of the mammalian Asx homologs. Mutations in the ASXL1 gene are frequently found in myeloid neoplasms, breast cancers, and prostate cancers (PMID: 30013160; PMID: 22436456; PMID: 26470845). In patients with myeloid malignancies, ASXL1 mutations are mostly heterozygous frameshift or nonsense mutations that result in C-terminal truncation (PMID: 30982744; PMID: 26095772; PMID: 32683582; PMID: 29643185).



