• Featured Product

ATF6 Polyclonal antibody

ATF6 antibodies are primarily used to investigate endoplasmic reticulum stress and the unfolded protein response by detecting ATF6 activation in cells and tissues. Proteintech has an extensive range of ATF6 antibodies validated for WB, IHC, IF/ICC, FC (Intra), IP, ELISA and more.

Cat No. 24169-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (4)

Applications

WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA

activating transcription factor 6, ATF 6, ATF6 alpha, ATF6A, ATF6-alpha

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inA549 cells, HEK-293 cells, HeLa cells, MCF-7 cells, mouse liver tissue, rat liver, rat liver tissue
Positive IP detected inHeLa cells
Positive IHC detected inhuman cervical cancer tissue, human breast hyperplasia tissue, human pancreas cancer tissue, human pancreas tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHeLa cells
Positive FC (Intra) detected inHeLa cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:2000-1:10000
Immunoprecipitation (IP)IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
Immunohistochemistry (IHC)IHC : 1:20-1:200
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
Flow Cytometry (FC) (INTRA)FC (INTRA) : 0.40 ug per 10^6 cells in a 100 µl suspension
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

24169-1-AP targets ATF6 in WB, IHC, IF/ICC, FC (Intra), IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat, pig, monkey, chicken, bovine
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag21456

Product name: Recombinant human ATF6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-194 aa of BC014969

Sequence: MGEPAGVAGTMESPFSPGLFHRLDEDWDSALFAELGYFTDTDELQLEAANETYENNFDNLDFDLDLVPWESDIWDINNQICTVKDIKAEPQPLSPASSSYSVSSPRSVDSYSSTQHVPEELDLSSSSQMSPLSLYGENSNSLSSAEPLKEDKPVTGPRNKTENGLTPKKKIQVNSKPSIQPKPLLLPAAPKTQT

Predict reactive species
Full Name activating transcription factor 6
Calculated Molecular Weight 75 kDa
Observed Molecular Weight60-70 kDa, 90-100 kDa
GenBank Accession NumberBC014969
Gene Symbol ATF6
Gene ID (NCBI) 22926
RRIDAB_2876891
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDP18850
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Activating transcription factor 6 (ATF6) is a transcription factor that acts during endoplasmic reticulum stress by activating unfolded protein response target genes. ATF6 is the common name for this protein, sometimes also called ATF6A, to distinguish it from the paralogous gene ATF6B. The genes for ATF6A and ATF6B are located on different chromosomes. Binds DNA on the 5'-CCAC[GA]-3'half of the ER stress response element (ERSE) (5'-CCAAT-N(9)-CCAC[GA]-3') and of ERSE II (5'-ATTGG-N-CCACG-3'). Binding to ERSE requires binding of NF-Y to ERSE. Could also be involved in activation of transcription by the serum response factor.During unfolded protein response an approximative 50 kDa fragment containing the cytoplasmic transcription factor domain is released by proteolysis. The cleavage seems to be performed sequentially by site-1 and site-2 proteases. The fully glycosylated form of ATF6, a 670 amino acid protein, exhibits an electrophoretic mobility of ~90 kDa in denaturing SDS-gels, in part because of the glycosylated modifications. ATF6 has 3 consensus sites for N-linked glycosylation and exists constitutively as a glycosylated protein. Differentially glycosylated ATF6 forms may result from mutations or experimental treatment (PMID:15804611) (PMID:14699159). The antibody recognizes cleaved and fully glycosylated forms of ATF6.

Protocols

Product Specific Protocols
IF protocol for ATF6 antibody 24169-1-APDownload protocol
IHC protocol for ATF6 antibody 24169-1-APDownload protocol
IP protocol for ATF6 antibody 24169-1-APDownload protocol
WB protocol for ATF6 antibody 24169-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB

Cell Stem Cell

Amino acid catabolism regulates hematopoietic stem cell proteostasis via a GCN2-eIF2α axis.

Authors - Changzheng Li
humanWB

J Clin Invest

Flavin-containing monooxygenase 2 confers cardioprotection in ischemia models through its disulfide-bond catalytic activity

Authors - Qingnian Liu
mouseWB

J Clin Invest

Inhibition of the unfolded protein response reduces arrhythmia risk after myocardial infarction.

Authors - Man Liu
humanIP

J Clin Invest

Ubiquitination of ATF6 by disease-associated RNF186 promotes the innate receptor-induced unfolded protein response.

Authors - Kishu Ranjan
mouseWB

J Clin Invest

Sec13 promotes oligodendrocyte differentiation and myelin repair through autocrine pleiotrophin signaling.

Authors - Zhixiong Liu
humanWB

Circ Res

ATF6 Decreases Myocardial Ischemia/Reperfusion Damage and Links ER Stress and Oxidative Stress Signaling Pathways in the Heart.

Authors - Jung-Kang Jin

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Morgane (Verified Customer) (02-21-2025)

Antibody is specific and allows to detect the cleaved form of ATF6 upon Stress

  • Applications: Western Blot
  • Primary Antibody Dilution: 1/2000
  • Cell Tissue Type: HCT116 colon
ATF6 Antibody Western Blot validation (1/2000 dilution) in HCT116 colon (Cat no:24169-1-AP)
FH

Richard (Verified Customer) (11-12-2019)

The antibody works well and gives two clean bands for cleaved and uncleaved ATF6 by western blot.

  • Applications: Western Blot,
  • Primary Antibody Dilution: 1:3000
  • Cell Tissue Type: HeLa, HEK293T
Loading...
||
New chat

Able

正在加载,请稍候...