ATF7 Polyclonal antibody

• 

  WB analysis using 29770-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 29770-1-AP (ATF7 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of mouse lung using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse lung using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human urothelial carcinoma using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded human urothelial carcinoma tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse heart using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse heart tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat heart using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded rat heart tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of rat lung using 29770-1-AP

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 29770-1-AP (ATF7 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

ATF7 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 29770-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF, ELISA

Synonyms

ATFA

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IHC detected in: human lung tissue, mouse lung tissue, human urothelial carcinoma tissue, mouse heart tissue, rat heart tissue, rat lung tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

29770-1-AP targets ATF7 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30882

  Product name: Recombinant human ATF7 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 78-167 aa of NM_001366555

  Sequence: FKKAADEDEKKARSRTVAKKLVAAAGPLDMSLPSTPDIKIKEEEPVEVDSSPPDSPASSPCSPPLKEKEVTPKPVLISTPTPTIVRPGSL

• Full Name: activating transcription factor 7
• Calculated Molecular Weight: 53 kDa
• Observed Molecular Weight: 52-60 kDa
• GenBank Accession Number: NM_001366555
• Gene Symbol: ATF7
• Gene ID (NCBI): 11016
• RRID: AB_3086157
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P17544
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Acta Pharmacol Sin; CircSARS-CV2-N1368 from SARS-CoV-2 impairs endothelial cell function through the upregulation of ATF7 to activate TLR4/NF-κB/ROS signaling; Authors - Yi-Hong Wen