ATG12 Polyclonal antibody

• 

  WB analysis of human bladder using 11122-1-AP

  human bladder tissue were subjected to SDS PAGE followed by western blot with 11122-1-AP (ATG12 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of UV treated HEK-293 using 11122-1-AP

  UV treated HEK-293 cells were subjected to SDS PAGE followed by western blot with 11122-1-AP (ATG12 antibody) at dilution of 1:100 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HEK-293 using 11122-1-AP

  IP result of anti-ATG12 (IP:11122-1-AP, 4ug; Detection:11122-1-AP 1:300) with HEK-293 cells lysate 880ug.

• 

  IHC staining of human prostate cancer using 11122-1-AP

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11122-1-AP (ATG12 antibody) at dilution of 1:50 (under 10x lens).

ATG12 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 11122-1-AP

Publications(38)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (3)

Applications

WB, IHC, IF, IP, CoIP, ELISA

Synonyms

APG12, APG12 like, APG12L, ATG12, Autophagy related protein 12, FBR93, HAPG12, Ubiquitin like protein ATG12

---

Tested Applications

• Positive WB detected in: human bladder tissue, UV treated HEK-293
• Positive IP detected in: HEK-293 cells
• Positive IHC detected in: human prostate cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 31 publications below
• IHC: See 5 publications below
• IF: See 2 publications below
• CoIP: See 1 publications below

Product Information

11122-1-AP targets ATG12 in WB, IHC, IF, IP, CoIP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat, pig, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag1586

  Product name: Recombinant human ATG12 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-187 aa of BC011033

  Sequence: MTSREHQVSLCNCVPLLRRLLCDAPWRKARPLHALSRYFRSRVSPSKMAEEPQSVLQLPTSIAAGGEGLTDVSPETTTPEPPSSAAVSPGTEEPAGDTKKKIDILLKAVGDTPIMKTKKWAVERTRTIQGLIDFIKKFLKLVASEQLFIYVNQSFAPSPDQEVGTLYECFGSDGKLVLHYCKSQAWG

• Full Name: ATG12 autophagy related 12 homolog (S. cerevisiae)
• Calculated Molecular Weight: 16 kDa
• Observed Molecular Weight: 48-50 kDa
• GenBank Accession Number: BC011033
• Gene Symbol: ATG12
• Gene ID (NCBI): 9140
• RRID: AB_2059368
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O94817
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATG12, also named as APG12 and APG12L, belongs to the ATG12 family. It is required for autophagy. Free ATG12 is 15kd or 8kd. Conjugated to ATG5, ATG12-ATG5 show 48-55kd.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Mol Cell; AMPK-Dependent Phosphorylation of GAPDH Triggers Sirt1 Activation and Is Necessary for Autophagy upon Glucose Starvation.; Authors - Chunmei Chang
mouse	WB	Nat Commun; Sirt6 deficiency exacerbates podocyte injury and proteinuria through targeting Notch signaling.; Authors - Min Liu
human	IHC	Theranostics; Down-regulated miR-23a Contributes to the Metastasis of Cutaneous Melanoma by Promoting Autophagy.; Authors - Weinan Guo
human	WB	Cancer Lett; Let-7i-5p promotes a malignant phenotype in nasopharyngeal carcinoma via inhibiting tumor-suppressive autophagy.; Authors - Bo You
human	WB	Cell Death Dis; The lncRNA HULC functions as an oncogene by targeting ATG7 and ITGB1 in epithelial ovarian carcinoma.; Authors - Shuo Chen
human	IHC	Am J Physiol Cell Physiol; ALKBH5 promotes autophagy and progression by mediating m6A methylation of lncRNA UBOX5-AS1 in endometriosis; Authors - Hengwei Liu

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Priya (Verified Customer) (06-21-2023)

Used this antibody for Caco2 cells andmice tissue

• Applications: Western Blot
• Primary Antibody Dilution: 1 to 1000
• Cell Tissue Type: Caco2, Mice colon