Tested Applications
Positive WB detected in | L02 cells, MKN-45 cells |
Positive IHC detected in | human stomach cancer tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1500 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
27467-1-AP targets ATG4A in WB, IHC, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag26497 Product name: Recombinant human ATG4A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 162-247 aa of BC061696 Sequence: DEWNSLAVYVSMDNTVVIEDIKKMCRVLPLSADTAGDRPPDSLTASNQSKGTSAYCSAWKPLLLIVPLRLGINQINPVYVDAFKEC Predict reactive species |
Full Name | ATG4 autophagy related 4 homolog A (S. cerevisiae) |
Calculated Molecular Weight | 45 kDa |
Observed Molecular Weight | 45 kDa |
GenBank Accession Number | BC061696 |
Gene Symbol | ATG4A |
Gene ID (NCBI) | 115201 |
RRID | AB_2880879 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8WYN0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATG4, a member of the cysteine protease family, plays an important role in autophagy induction. ATG4 enzymes cleave the C-terminal amino acid of ATG8 family proteins to reveal a C-terminal glycine that is essential for ATG8 proteins conjugation to phosphatidylethanolamine (PE) and insertion to membranes. ATG4A, which may be a target for cancer prevention and intervention, has been reported to be related to breast tumorigenesis, lung cancer, ovarian cancer, cervical cancer and gastric cancer. (PMID: 27276686, 29435029, 28636635)
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ATG4A antibody 27467-1-AP | Download protocol |
IHC protocol for ATG4A antibody 27467-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |