ATIC Recombinant monoclonal antibody, PBS Only (Capture)

• 

  Sandwich ELISA standard curve of MP01575-1

  Sandwich ELISA standard curve of MP01575-1, Human ATIC Recombinant Matched Antibody Pair - PBS only. 84798-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1052. 84798-1-PBS was HRP conjugated as the detection antibody. Range: 1.56-100 ng/mL.

• 

  Sample test of MP01575-1

  The mean ATIC concentration was determined to be 621.43 ng/mL in HepG2 cell extract based on a 1.00 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP01575-1

  Cytometric bead array standard curve of MP01575-1, ATIC Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 84798-3-PBS. Detection antibody: 84798-1-PBS. Standard: Ag1052. Range: 0.781-100 ng/mL.

ATIC Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 84798-3-PBS

Clone No.242324D8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

AICARFT, AICAR transformylase/inosine monophosphate cyclohydrolase, AICAR formyltransferase, AICAR, 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase

---

Product Information

84798-3-PBS targets ATIC as part of a matched antibody pair:

MP01575-1: 84798-3-PBS capture and 84798-1-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1052

  Product name: Recombinant human ATIC protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 291-592 aa of BC008879

  Sequence: DLYKTLTPISAAYARARGADRMSSFGDFVALSDVCDVPTAKIISREVSDGIIAPGYEEEALTILSKKKNGNYCVLQMDQSYKPDENEVRTLFGLHLSQKRNNGVVDKSLFSNVVTKNKDLPESALRDLIVATIAVKYTQSNSVCYAKNGQVIGIGAGQQSRIHCTRLAGDKANYWWLRHHPQVLSMKFKTGVKRAEISNAIDQYVTGTIGEDEDLIKWKALFEEVPELLTEAEKKEWVEKLTEVSISSDAFFPFRDNVDRAKRSGVAYIAAPSGSAADKVVIEACDELGIILAHTNLRLFHH

• Full Name: 5-aminoimidazole-4-carboxamide ribonucleotide formyltransferase/IMP cyclohydrolase
• Calculated Molecular Weight: 65 kDa
• GenBank Accession Number: BC008879
• Gene Symbol: ATIC
• Gene ID (NCBI): 471
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P31939
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.