ATM Monoclonal antibody

• 

  WB analysis using 67586-1-Ig

  Various lysates were subjected to SDS PAGE followed by western blot with 67586-1-Ig (ATM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HSC-T6 using 67586-1-Ig

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67586-1-Ig (ATM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

ATM Monoclonal Antibody for WB, ELISA

Cat No. 67586-1-Ig

Clone No.3E6F4

Publications(4)

Host / Isotype

Mouse / IgG1

Reactivity

human, rat and More (1)

Applications

WB, IF, ELISA

Synonyms

3E6F4, A T mutated, A-T mutated, EC:2.7.11.1, Serine-protein kinase ATM

---

Tested Applications

• Positive WB detected in: HeLa cells, HSC-T6 cells, HEK-293 cells, HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below

Product Information

67586-1-Ig targets ATM in WB, IF, ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Cited Reactivity: human, rat, pig
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30001

  Product name: Recombinant human ATM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1059-1361 aa of BC137169

  Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG

• Full Name: ataxia telangiectasia mutated
• Observed Molecular Weight: 310-350 kDa
• GenBank Accession Number: BC137169
• Gene Symbol: ATM
• Gene ID (NCBI): 472
• RRID: AB_2882795
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: Q13315
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
pig	WB	Signal Transduct Target Ther; In vivo evaluation of guide-free Cas9-induced safety risks in a pig model; Authors - Weikai Ge
human	WB	J Mol Med (Berl); High expression of BCAT1 sensitizes AML cells to PARP inhibitor by suppressing DNA damage response; Authors - Jiajia Pan
rat	WB,IF	CNS Neurosci Ther; Multiple sevoflurane exposures during mid-trimester induce neurotoxicity in the developing brain initiated by 15LO2-Mediated ferroptosis; Authors - Qian Jiang
human	WB	Food Chem Toxicol; DON entry into the nucleus induces DNA damage, apoptosis and cycle arrest in GES-1 cells; Authors - Silu Hou