ATM Monoclonal antibody, PBS Only

• 

  WB analysis using 67586-1-Ig (same clone as 67586-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67586-1-Ig (ATM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67586-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67586-1-Ig (same clone as 67586-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67586-1-Ig (ATM antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67586-1-PBS in a different storage buffer formulation.

ATM Monoclonal Antibody for WB, Indirect ELISA

Cat No. 67586-1-PBS

Clone No.3E6F4

Host / Isotype

Mouse / IgG1

Reactivity

human, rat

Applications

WB, Indirect ELISA

Synonyms

3E6F4, A T mutated, A-T mutated, EC:2.7.11.1, Serine-protein kinase ATM

---

Product Information

67586-1-PBS targets ATM in WB, Indirect ELISA applications and shows reactivity with human, rat samples.

• Tested Reactivity: human, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag30001

  Product name: Recombinant human ATM protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1059-1361 aa of BC137169

  Sequence: SSEFENKQALLKRAKEEVGLLREHKIQTNRYTVKVQRELELDELALRALKEDRKRFLCKAVENYINCLLSGEEHDMWVFRLCSLWLENSGVSEVNGMMKRDGMKIPTYKFLPLMYQLAARMGTKMMGGLGFHEVLNNLISRISMDHPHHTLFIILALANANRDEFLTKPEVARRSRITKNVPKQSSQLDEDRTEAANRIICTIRSRRPQMVRSVEALCDAYIILANLDATQWKTQRKGINIPADQPITKLKNLEDVVVPTMEIKVDHTGEYGNLVTIQSFKAEFRLAGGVNLPKIIDCVGSDG

• Full Name: ataxia telangiectasia mutated
• Observed Molecular Weight: 310-350 kDa
• GenBank Accession Number: BC137169
• Gene Symbol: ATM
• Gene ID (NCBI): 472
• RRID: AB_2882795
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13315
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The ATM protein is a member of the phosphatidylinositol 3-kinase family of proteins that respond to DNA damage by phosphorylating key substrates involved in DNA repair and/or cell cycle control. It is involved in mitogenic signal transduction, meiotic recombination, detection of DNA damage, and cell cycle control.