ATM Fusion Protein

Source

e coli.-derived, PKG

Tag

GST

Format

Liquid

Cat no : Ag15123

Synonyms

AT1; ATA; ATC; ATD; ATDC; ATE; DKFZp781A0353; MGC74674; TEL1; TELO1



Product Information

Peptide Sequence IDHLFISNLPEIVVELLMTLHEPANSSASQSTDLCDFSGDLDPAPNPPHFPSHVVKATFAYISNCHKTKLKSILEILSKSPDSYQKILLAICEQAAETNNVYKKHRILKIYHLFVSLLLKDIKSGLGGAWAFVLRDVIYTLIHYINQR
(1332-1479 aa encoded by BC007023)
Activity Not tested.
Endotoxin Level Please contact the lab for more information.
Formulation The purified protein was resolved in 1M PBS (58mM Na2HPO4,17mM NaH2PO4, 68mM NaCl, pH8. ) added with 100mM GSH and 15%glycerol.