Tested Applications
| Positive WB detected in | A375 cells, A549 cells, HEK-293T cells, NCI-H1299 cells, HEK-293 cells |
| Positive IHC detected in | human prostate hyperplasia tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | PC-3 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| WB | See 4 publications below |
| IF | See 1 publications below |
Product Information
22641-1-AP targets ATOX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag18460 Product name: Recombinant human ATOX1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-68 aa of BC112248 Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE Predict reactive species |
| Full Name | ATX1 antioxidant protein 1 homolog (yeast) |
| Calculated Molecular Weight | 68 aa, 8 kDa |
| Observed Molecular Weight | 7 kDa |
| GenBank Accession Number | BC112248 |
| Gene Symbol | ATOX1 |
| Gene ID (NCBI) | 475 |
| RRID | AB_2879139 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O00244 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Antioxidant 1 (ATOX1) is a copper chaperone to regulate copper homeostasis in cell. In the cytosol, ATOX1 always binds to copper and transfer to ATPase proteins in the trans-Golgi network, thereby promoting copper supply to various copper-dependent oxidereductases matured within the secretory vesicles (PMID: 28294521). Also, the protein could protect cells against oxidative damage and the expression levels of ATOX1 may help to the inflammatory response and antioxidant defense,even to modulate response to the cancer (PMID: 27472369). ATOX1 plays an important role in the physiology of the human central nervous system ,and it's highly expressed in the cerebral cortex and hippocampus (PMID: 30545441). Either cytosol or nucleus location of ATOX1 has been reported in different literations, which may be associated with cell status (PMID: 24445997; 31317143).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for ATOX1 antibody 22641-1-AP | Download protocol |
| IHC protocol for ATOX1 antibody 22641-1-AP | Download protocol |
| WB protocol for ATOX1 antibody 22641-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Redox Biol Atox1 protects hippocampal neurons after traumatic brain injury via DJ-1 mediated anti-oxidative stress and mitophagy | ||
J Nanobiotechnology Rationally designed catalytic nanoplatform for enhanced chemoimmunotherapy via deploying endogenous plus exogenous copper and remodeling tumor microenvironment | ||
Biomedicines COMMD3 Regulates Copper Metabolism via the ATOX1-ATP7A-LOX Axis to Promote Multiple Myeloma Progression | ||
iScience Hepatic depletion of nucleolar protein mDEF causes excessive mitochondrial copper accumulation associated with p53 and NRF1 activation |











