ATOX1 Polyclonal antibody

• 

  WB analysis using 22641-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22641-1-AP (ATOX1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 22641-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 22641-1-AP (ATOX1 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293T using 22641-1-AP

  HEK-293T cells were subjected to SDS PAGE followed by western blot with 22641-1-AP (ATOX1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of A549 using 22641-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 22641-1-AP (ATOX1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human liver cancer using 22641-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver cancer tissue slide using 22641-1-AP (ATOX1 Antibody) at dilution of 1:50 (under 10x lens).

• 

  IF Staining of PC-3 using 22641-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed PC-3 cells using ATOX1 antibody (22641-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

ATOX1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 22641-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IF/ICC, ELISA

Synonyms

ATX1, ATOX 1, Antioxidant 1

---

Tested Applications

• Positive WB detected in: A375 cells, A549 cells, HEK-293T cells, NCI-H1299 cells, HEK-293 cells
• Positive IHC detected in: human liver cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: PC-3 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 4 publications below
• IF: See 1 publications below

Product Information

22641-1-AP targets ATOX1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag18460

  Product name: Recombinant human ATOX1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-68 aa of BC112248

  Sequence: MPKHEFSVDMTCGGCAEAVSRVLNKLGGVKYDIDLPNKKVCIESEHSMDTLLATLKKTGKTVSYLGLE

• Full Name: ATX1 antioxidant protein 1 homolog (yeast)
• Calculated Molecular Weight: 68 aa, 8 kDa
• Observed Molecular Weight: 7 kDa
• GenBank Accession Number: BC112248
• Gene Symbol: ATOX1
• Gene ID (NCBI): 475
• RRID: AB_2879139
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00244
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Antioxidant 1 (ATOX1) is a copper chaperone to regulate copper homeostasis in cell. In the cytosol, ATOX1 always binds to copper and transfer to ATPase proteins in the trans-Golgi network, thereby promoting copper supply to various copper-dependent oxidereductases matured within the secretory vesicles (PMID: 28294521). Also, the protein could protect cells against oxidative damage and the expression levels of ATOX1 may help to the inflammatory response and antioxidant defense,even to modulate response to the cancer (PMID: 27472369). ATOX1 plays an important role in the physiology of the human central nervous system ,and it's highly expressed in the cerebral cortex and hippocampus (PMID: 30545441). Either cytosol or nucleus location of ATOX1 has been reported in different literations, which may be associated with cell status (PMID: 24445997; 31317143).

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IF	Redox Biol; Atox1 protects hippocampal neurons after traumatic brain injury via DJ-1 mediated anti-oxidative stress and mitophagy; Authors - Pengzhan Zhao
mouse	WB	J Nanobiotechnology; Rationally designed catalytic nanoplatform for enhanced chemoimmunotherapy via deploying endogenous plus exogenous copper and remodeling tumor microenvironment; Authors - Daxi Sun
human	WB	Biomedicines; COMMD3 Regulates Copper Metabolism via the ATOX1-ATP7A-LOX Axis to Promote Multiple Myeloma Progression; Authors - Yajun Wang
mouse	WB	iScience; Hepatic depletion of nucleolar protein mDEF causes excessive mitochondrial copper accumulation associated with p53 and NRF1 activation; Authors - Jinsong Wei