ATP1B1 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 15192-1-AP (same clone as 15192-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 15192-1-AP (ATP1B1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 15192-1-AP (same clone as 15192-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 15192-1-AP (ATP1B1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 15192-1-AP (same clone as 15192-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 15192-1-AP (ATP1B1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human brain using 15192-1-AP (same clone as 15192-1-PBS)

  human brain tissue were subjected to SDS PAGE followed by western blot with 15192-1-AP (ATP1B1 antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 15192-1-AP (same clone as 15192-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 15192-1-AP (ATP1B1 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 15192-1-AP (same clone as 15192-1-PBS)

  IP result of anti-ATP1B1 (IP:15192-1-AP, 4ug; Detection:15192-1-AP 1:2000) with mouse brain tissue lysate 1600 ug. This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15192-1-AP (same clone as 15192-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15192-1-AP (ATP1B1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human brain using 15192-1-AP (same clone as 15192-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human brain using 15192-1-AP (ATP1B1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 15192-1-AP (same clone as 15192-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 15192-1-AP (ATP1B1 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skeletal muscle using 15192-1-AP (same clone as 15192-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skeletal muscle using 15192-1-AP (ATP1B1 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HEK-293 using 15192-1-AP (same clone as 15192-1-PBS)

  Immunofluorescent analysis of HEK-293 cells using 15192-1-AP (ATP1B1 antibody) at dilution of 1:25 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 15192-1-PBS in a different storage buffer formulation.

ATP1B1 Polyclonal Antibody for WB, IHC, IF/ICC, IP, Indirect ELISA

Cat No. 15192-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, IP, Indirect ELISA

Synonyms

Sodium/potassium-transporting ATPase subunit beta-1, Sodium/potassium-dependent ATPase subunit beta-1, Na+/K+ ATPase beta 1 subunit, Na, K-ATPase β1, Beta 1 subunit of Na(+) K(+) ATPase

---

Product Information

15192-1-PBS targets ATP1B1 in WB, IHC, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7279

  Product name: Recombinant human ATP1B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 59-303 aa of BC000006

  Sequence: LTISEFKPTYQDRVAPPGLTQIPQIQKTEISFRPNDPKSYEAYVLNIVRFLEKYKDSAQRDDMIFEDCGDVPSEPKERGDFNHERGERKVCRFKLEWLGNCSGLNDETYGYKEGKPCIIIKLNRVLGFKPKPPKNESLETYPVMKYNPNVLPVQCTGKRDEDKDKVGNVEYFGLGNSPGFPLQYYPYYGKLLQPKYLQPLLAVQFTNLTMDTEIRIECKAYGENIGYSEKDRFQGRFDVKIEVKS

• Full Name: ATPase, Na+/K+ transporting, beta 1 polypeptide
• Calculated Molecular Weight: 35 kDa
• Observed Molecular Weight: 45-52 kDa
• GenBank Accession Number: BC000006
• Gene Symbol: ATP1B1
• Gene ID (NCBI): 481
• RRID: AB_2290040
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P05026
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP1B1 is one of beta subunits of the Na+/K+ ATPase and responsible for formation and structural integrity of the Na+/K+ ATPase. The Na+/K+ ATPase is a plasma membrane pump consisting of alpha, beta, and gamma subunits. At least four of Na+/K+-ATPase beta subunits (β1, β2, β3, β4) have been identified in mammalian cells; the β1-subunit (ATP1B1) is the most ubiquitous. The Na+/K+ ATPase β subunits have multiple N-glycosylation sites. The predicted MW of ATP1B1 is 35 kDa, while it migrates around 40-52 kDa due to the variable glycosylation. (PMID: 10896885, 17714085)