Product Information
83827-3-PBS targets ATP2B1 in WB, IHC, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Recombinant |
Type | Antibody |
Immunogen |
CatNo: Ag32423 Product name: Recombinant human ATP2B1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 2-89 aa of NM_001001323.1 Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF Predict reactive species |
Full Name | ATPase, Ca++ transporting, plasma membrane 1 |
Calculated Molecular Weight | 135 kDa |
Observed Molecular Weight | 130 kDa |
GenBank Accession Number | NM_001001323.1 |
Gene Symbol | ATP2B1 |
Gene ID (NCBI) | 490 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Protein A purification |
UNIPROT ID | P20020 |
Storage Buffer | PBS only, pH 7.3. |
Storage Conditions | Store at -80°C. |
Background Information
ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160).