ATP2B1 Recombinant monoclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 83827-3-RR (same clone as 83827-3-PBS)

  unboiled mouse brain tissue were subjected to SDS PAGE followed by western blot with 83827-3-RR (ATP2B1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 83827-3-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse small intestine using 83827-3-RR (same clone as 83827-3-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse small intestine tissue slide using 83827-3-RR (ATP2B1 antibody) at dilution of 1:0 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 83827-3-PBS in a different storage buffer formulation.

• 

  Affinity and Kinetic Characterization of 83827-3-PBS

  Biolayer interferometry (BLl) kinetic assay of 83827-3-PBS against Human ATP2B1 was performed. The affinity constant is 4.46 nM.

• 

  Affinity and Kinetic Characterization of 83827-3-RR

  Biolayer interferometry (BLl) kinetic assays of 83827-3-RR against Human ATP2B1 were performed. The affinity constant is 10.3 nM.

ATP2B1 Uni-rAb^® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA

Cat No. 83827-3-PBS

Clone No.240848D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

Synonyms

240848D10, PMCA1, PMCA1kb

---

Product Information

83827-3-PBS targets ATP2B1 in WB, IHC, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag32423

  Product name: Recombinant human ATP2B1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 2-89 aa of NM_001001323.1

  Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF

• Full Name: ATPase, Ca++ transporting, plasma membrane 1
• Calculated Molecular Weight: 135 kDa
• Observed Molecular Weight: 130 kDa
• GenBank Accession Number: NM_001001323.1
• Gene Symbol: ATP2B1
• Gene ID (NCBI): 490
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P20020
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160).