ATP2B1 Recombinant monoclonal antibody, PBS Only

ATP2B1 Uni-rAb® Recombinant Antibody for WB, IHC, Cytometric bead array, Indirect ELISA
Cat No. 83827-3-PBS
Clone No.240848D10

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Cytometric bead array, Indirect ELISA

240848D10, PMCA1, PMCA1kb

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

83827-3-PBS targets ATP2B1 in WB, IHC, Cytometric bead array, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag32423

Product name: Recombinant human ATP2B1 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 2-89 aa of NM_001001323.1

Sequence: GDMANNSVAYSGVKNSLKEANHDGDFGITLAELRALMELRSTDALRKIQESYGDVYGICTKLKTSPNEGLSGNPADLERREAVFGKNF

Predict reactive species
Full Name ATPase, Ca++ transporting, plasma membrane 1
Calculated Molecular Weight135 kDa
Observed Molecular Weight130 kDa
GenBank Accession NumberNM_001001323.1
Gene Symbol ATP2B1
Gene ID (NCBI) 490
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP20020
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

ATPase plasma membrane Ca2+ transporting 1 (ATP2B1, also known as plasma membrane Ca2+ pump isoform 1; PMCA1) belongs to the family of ATP-driven calmodulin-dependent Ca2+ pumps that participate in the regulation of intracellular free Ca2+ (PMID:35358416). The ATP2B1 contents of extracellular vesicles are increased in prostate cancer treated with enzalutamide and are negatively regulated by androgen receptors (PMID:29105980). ATP2B1 plays an important role in the prognosis of cholangiocarcinoma. Furthermore, ATP2B1 plays an important role in the prognosis of cholangiocarcinoma and can be a prognostic factor for cholangiocarcinoma (PMID:35875160).

Loading...
||
New chat Able
正在加载,请稍候...