ATP2B3/PMCA3 Polyclonal antibody

• 

  WB analysis using 31692-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31692-1-AP (ATP2B3/PMCA3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 31692-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 31692-1-AP (ATP2B3/PMCA3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

ATP2B3/PMCA3 Polyclonal Antibody for WB, ELISA

Cat No. 31692-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, ELISA

Synonyms

ATP2B3, PMCA3

---

Tested Applications

• Positive WB detected in: 37°C incubated mouse brain tissue, 37°C incubated rat brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

31692-1-AP targets ATP2B3/PMCA3 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35923

  Product name: Recombinant human ATP2B3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of BC047580

  Sequence: MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKT

• Full Name: ATPase, Ca++ transporting, plasma membrane 3
• Observed Molecular Weight: 134 kDa
• GenBank Accession Number: BC047580
• Gene Symbol: ATP2B3
• Gene ID (NCBI): 492
• RRID: AB_3670080
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q16720
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

ATP2B3 also known as PMCA3, belongs to the family of P-type primary ion transport ATPases. ATP2B3 uses ATP as an energy source to transport cytosolic Ca2+ ions across the plasma membrane to the extracellular compartment. ATP2B3 is highly expressed in the brain and cerebellum and is important in regulating neuronal Ca2+. Mutations in ATP2B3 are associated with X-linked spinocerebellar ataxia-1 (PMID: 25953895, 22912398).