ATP2B3/PMCA3 Polyclonal antibody, PBS Only

• 

  WB analysis using 31692-1-AP (same clone as 31692-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31692-1-AP (ATP2B3/PMCA3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31692-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 31692-1-AP (same clone as 31692-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 31692-1-AP (ATP2B3/PMCA3 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 31692-1-PBS in a different storage buffer formulation.

ATP2B3/PMCA3 Polyclonal Antibody for WB, Indirect ELISA

Cat No. 31692-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

31692-1-PBS targets ATP2B3/PMCA3 in WB, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag35923

  Product name: Recombinant human ATP2B3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-97 aa of BC047580

  Sequence: MGDMANSSIEFHPKPQQQRDVPQAGGFGCTLAELRTLMELRGAEALQKIEEAYGDVSGLCRRLKTSPTEGLADNTNDLEKRRQIYGQNFIPPKQPKT

• Full Name: ATPase, Ca++ transporting, plasma membrane 3
• Observed Molecular Weight: 134 kDa
• GenBank Accession Number: BC047580
• Gene Symbol: ATP2B3
• Gene ID (NCBI): 492
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity Purification
• UNIPROT ID: Q16720
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

ATP2B3 also known as PMCA3, belongs to the family of P-type primary ion transport ATPases. ATP2B3 uses ATP as an energy source to transport cytosolic Ca2+ ions across the plasma membrane to the extracellular compartment. ATP2B3 is highly expressed in the brain and cerebellum and is important in regulating neuronal Ca2+. Mutations in ATP2B3 are associated with X-linked spinocerebellar ataxia-1 (PMID: 25953895, 22912398).