ATP6V1C2 Polyclonal antibody

• 

  WB analysis of mouse kidney using 16274-1-AP

  mouse kidney tissue were subjected to SDS PAGE followed by western blot with 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human kidney using 16274-1-AP

  human kidney tissue were subjected to SDS PAGE followed by western blot with 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human heart using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human kidney using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human kidney using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human placenta using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human liver using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human liver using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human lung using 16274-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung using 16274-1-AP (ATP6V1C2 antibody) at dilution of 1:50 (under 40x lens).

• Featured Product
• KD/KO Validated

ATP6V1C2 Polyclonal Antibody for WB, ELISA

Cat No. 16274-1-AP

Publications(4)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, IF, ELISA

Synonyms

ATP6C2, V-ATPase subunit C 2, VMA5, V-type proton ATPase subunit C 2

---

Tested Applications

• Positive WB detected in: mouse kidney tissue, human kidney tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 4 publications below
• IHC: See 1 publications below
• IF: See 1 publications below

Product Information

16274-1-AP targets ATP6V1C2 in WB, IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9349

  Product name: Recombinant human ATP6V1C2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-381 aa of BC012142

  Sequence: MSEFWLISAPGDKENLQALERMNTVTSKSNLSYNTKFAIPDFKVGTLDSLVGLSDELGKLDTFAESLIRRMAQSVVEVMEDSKGKVQEHLLANGVDLTSFVTHFEWDMAKYPVKQPLVSVVDTIAKQLAQIEMDLKSRTAAYDTLKTNLENLEKKSMGNLFTRTLSDIVSKEDFVLDSEYLVTLLVIVPKPNYSQWQKTYESLSDMVVPRSTKLITEDKEGGLFTVTLFRKVIEDFKTKAKENKFTVREFYYDEKEIEREREEMARLLSDKKQQYGPLLRWLKVNFSEAFIAWIHIKALRVFVESVLRYGLPVNFQAVLLQPHKKSSTKRLREVLNSVFRHLDEVAATSILDASVEIPGLQLNNQDYFPYVYFHIDLSLLD

• Full Name: ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C2
• Calculated Molecular Weight: 381 aa, 44 kDa
• Observed Molecular Weight: 44 kDa
• GenBank Accession Number: BC012142
• Gene Symbol: ATP6V1C2
• Gene ID (NCBI): 245973
• RRID: AB_2062522
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8NEY4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IF	Environ Health Perspect; Effects of Inorganic Arsenic on Human Prostate Stem-Progenitor Cell Transformation, Autophagic Flux Blockade, and NRF2 Pathway Activation.; Authors - Lishi Xie ; KD Validated
	WB	Nat Commun; Senescence-associated lysosomal dysfunction impairs cystine deprivation-induced lipid peroxidation and ferroptosis; Authors - Tze Mun Loo
human	WB,IHC	Front Genet; High Expression of ATP6V1C2 Predicts Unfavorable Overall Survival in Patients With Colon Adenocarcinoma; Authors - Guanghua Li
human	WB	Pathol Res Pract; Comprehensive analysis of ATP6V1s family member, ATP6V1C2, with prognostic and drug development values in colorectal cancer; Authors - Jun Li