Tested Applications
Positive WB detected in | MCF7 cells, HeLa cells, Jurkat cells, mouse liver tissue, mouse skeletal muscle tissue |
Positive IHC detected in | human testis tissue, human brain tissue, human kidney tissue, human pancreas tissue, human placenta tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
IHC | See 1 publications below |
CoIP | See 1 publications below |
Product Information
17725-1-AP targets ATP6V1F in WB, IHC, CoIP, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | human, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag12121 Product name: Recombinant human ATP6V1F protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-119 aa of BC107854 Sequence: MAGRGKLIAVIGDEDTVTGFLLGGIGELNKNRHPNFLVVEKDTTINEIEDTFRQFLNRDDIGIILINQYIAEMVRHALDAHQQSIPAVLEIPSKEHPYDAAKDSILRRARGMFTAEDLR Predict reactive species |
Full Name | ATPase, H+ transporting, lysosomal 14kDa, V1 subunit F |
Calculated Molecular Weight | 119 aa, 13 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC107854 |
Gene Symbol | ATP6V1F |
Gene ID (NCBI) | 9296 |
RRID | AB_2062680 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q16864 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
ATP6V1F(V-type proton ATPase subunit F) is also named as ATP6S14, VATF and belongs to the V-ATPase F subunit family. It generates an electrochemical proton gradient that is acid and positive inside synaptic vesicles. ATP6V1F plays a major role as energizers of animal plasma membranes, especially apical plasma membranes of epithelial cells. This protein has 2 isoforms produced by alternative splicing with the molecular weight of 14 kDa and 16 kDa.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ATP6V1F antibody 17725-1-AP | Download protocol |
IHC protocol for ATP6V1F antibody 17725-1-AP | Download protocol |
FC protocol for ATP6V1F antibody 17725-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Trace Elem Med Biol Study on the mechanism of arsenic-induced renal injury based on SWATH proteomics technology | ||
BMC Med Genomics ATP6V1F is a novel prognostic biomarker and potential immunotherapy target for hepatocellular carcinoma | ||
J Proteome Res Proteomic Investigation of Differential Interactomes of Glypican 1 and a Putative Disease-Modifying Variant of Ataxia | ||
Front Oncol Genome-wide association studies identify miRNA-194 as a prognostic biomarker for gastrointestinal cancer by targeting ATP6V1F, PPP1R14B, BTF3L4 and SLC7A5 |