Tested Applications
Positive WB detected in | rat brain tissue |
Positive IHC detected in | mouse brain tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 4 publications below |
Product Information
25316-1-AP targets ATP6V1G2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag18007 Product name: Recombinant human ATP6V1G2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 40-118 aa of BC119726 Sequence: AQMEVEQYRREREHEFQSKQQAAMGSQGNLSAEVEQATRRQVQGMQSSQQRNRERVLAQLLGMVCDVRPQVHPNYRISA Predict reactive species |
Full Name | ATPase, H+ transporting, lysosomal 13kDa, V1 subunit G2 |
Calculated Molecular Weight | 118 aa, 14 kDa |
Observed Molecular Weight | 14 kDa |
GenBank Accession Number | BC119726 |
Gene Symbol | ATP6V1G2 |
Gene ID (NCBI) | 534 |
RRID | AB_2880027 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | O95670 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ATP6V1G2 antibody 25316-1-AP | Download protocol |
IHC protocol for ATP6V1G2 antibody 25316-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
Nat Microbiol The interferon-inducible isoform of NCOA7 inhibits endosome-mediated viral entry. | ||
EBioMedicine A GBM-like V-ATPase signature directs cell-cell tumor signaling and reprogramming via large oncosomes. | ||
EBioMedicine Specific V-ATPase expression sub-classifies IDHwt lower-grade gliomas and impacts glioma growth in vivo. | ||
Proc Natl Acad Sci U S A Oxr1 and Ncoa7 regulate V-ATPase to achieve optimal pH for glycosylation within the Golgi apparatus and trans-Golgi network |