ATP8A1 Polyclonal antibody

• 

  WB analysis of mouse brain using 21565-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21565-1-AP (ATP8A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  WB analysis of mouse brain using 21565-1-AP

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 21565-1-AP (ATP8A1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

ATP8A1 Polyclonal Antibody for WB, ELISA

Cat No. 21565-1-AP

Publications(15)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF, ELISA

Synonyms

ATP8A1, ATPase II, ATPASEII, ATPIA, ATPP2, Chromaffin granule ATPase II

---

Tested Applications

• Positive WB detected in: mouse brain tissue

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 3 publications below
• WB: See 15 publications below
• IF: See 3 publications below

Product Information

21565-1-AP targets ATP8A1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag16071

  Product name: Recombinant human ATP8A1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 430-527 aa of BC109317

  Sequence: QNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLN

• Full Name: ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1
• Calculated Molecular Weight: 1164 aa, 131 kDa
• Observed Molecular Weight: 120 kDa
• GenBank Accession Number: BC109317
• Gene Symbol: ATP8A1
• Gene ID (NCBI): 10396
• RRID: AB_10734587
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y2Q0
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	EMBO J; Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase.; Authors - Shoken Lee
human	WB, IF	Proc Natl Acad Sci U S A; AP-3-dependent targeting of flippase ATP8A1 to lamellar bodies suppresses activation of YAP in alveolar epithelial type 2 cells.; Authors - Seunghyi Kook
mouse	WB	Sci Rep; Proteomic Analysis and Functional Characterization of P4-ATPase Phospholipid Flippases from Murine Tissues.; Authors - Jiao Wang
human	WB	Sci Rep; PPP1R12A is a recycling endosomal phosphatase that facilitates YAP activation; Authors - Chiaki Inoue ; KD Validated
human	WB	iScience; Lipid flippase dysfunction as a therapeutic target for endosomal anomalies in Alzheimer's disease.; Authors - Nanaka Kaneshiro
human	WB	Clin Proteomics; Identification of potential molecular targets for the treatment of cluster 1 human pheochromocytoma and paraganglioma via comprehensive proteomic characterization; Authors - Ondrej Vit

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Mareike (Verified Customer) (01-17-2025)

The sample must not be boiled before application!

• Applications: Western Blot
• Primary Antibody Dilution: 1:1000
• Cell Tissue Type: human breast cancer cell line MDA-MB-231 as wild type and Atp8a1 overexpression cell line

ATP8A1 Antibody Western Blot validation (1:1000 dilution) in human breast cancer cell line MDA-MB-231 as wild type and Atp8a1 overexpression cell line (Cat no:21565-1-AP)