Tested Applications
Positive WB detected in | mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 3 publications below |
WB | See 15 publications below |
IF | See 3 publications below |
Product Information
21565-1-AP targets ATP8A1 in WB, IF, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag16071 Product name: Recombinant human ATP8A1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 430-527 aa of BC109317 Sequence: QNSQFGDEKTFSDSSLLENLQNNHPTAPIICEFLTMMAVCHTAVPEREGDKIIYQAASPDEGALVRAAKQLNFVFTGRTPDSVIIDSLGQEERYELLN Predict reactive species |
Full Name | ATPase, aminophospholipid transporter (APLT), class I, type 8A, member 1 |
Calculated Molecular Weight | 1164 aa, 131 kDa |
Observed Molecular Weight | 120 kDa |
GenBank Accession Number | BC109317 |
Gene Symbol | ATP8A1 |
Gene ID (NCBI) | 10396 |
RRID | AB_10734587 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y2Q0 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for ATP8A1 antibody 21565-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
EMBO J Transport through recycling endosomes requires EHD1 recruitment by a phosphatidylserine translocase. | ||
Proc Natl Acad Sci U S A AP-3-dependent targeting of flippase ATP8A1 to lamellar bodies suppresses activation of YAP in alveolar epithelial type 2 cells. | ||
Sci Rep Proteomic Analysis and Functional Characterization of P4-ATPase Phospholipid Flippases from Murine Tissues. | ||
Sci Rep PPP1R12A is a recycling endosomal phosphatase that facilitates YAP activation
| ||
iScience Lipid flippase dysfunction as a therapeutic target for endosomal anomalies in Alzheimer's disease. | ||
Clin Proteomics Identification of potential molecular targets for the treatment of cluster 1 human pheochromocytoma and paraganglioma via comprehensive proteomic characterization |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Mareike (Verified Customer) (01-17-2025) | The sample must not be boiled before application!
![]() |