Product Information
22913-1-AP targets ATP8B2 in ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag19018 Product name: Recombinant human ATP8B2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1104-1209 aa of BC030288 Sequence: FLRLNLKPDLSDTVRYTQLVRKKQKAQHRCMRRVGRTGSRRSGYAFSHQEGFGELIMSGKNMRLSSLALSSFTTRSSSSWIESLRRKKSDSASSPSGGADKPLKG Predict reactive species |
| Full Name | ATPase, class I, type 8B, member 2 |
| Calculated Molecular Weight | 1209 aa, 137 kDa |
| GenBank Accession Number | BC030288 |
| Gene Symbol | ATP8B2 |
| Gene ID (NCBI) | 57198 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen Affinity purified |
| UNIPROT ID | P98198 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
